Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
C1R Synthetic Peptide – Cat# AAA201841 – Application Data Application Data (Host: RabbitTarget Name: C1RSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

C1R Blocking Peptide

C1R Peptide - middle region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C1R, Blocking Peptide; C1R Peptide - middle region; C1R blocking peptide
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ
Sequence Length
376
Applicable Applications for C1R blocking peptide
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C1R
Blocking Peptide
For anti-C1R (MBS3214644) antibody is Catalog # MBS3239581
Preparation and Storage
For short term use, store at 2-8 C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Host: RabbitTarget Name: C1RSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

C1R Synthetic Peptide – Cat# AAA201841 – Application Data Application Data (Host: RabbitTarget Name: C1RSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for C1R blocking peptide
This is a synthetic peptide designed for use in combination with anti-C1R Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for C1R blocking peptide

NCBI and Uniprot Product Information

NCBI GeneID
715
UniProt Accession #
Molecular Weight
41kDa

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The C1R (Catalog #AAA201841) is a Blocking Peptide produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1R Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C1R can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the C1R for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VDLDECASRS KSGEEDPQPQ CQHLCHNYVG GYFCSCRPGY ELQEDRHSCQ. It is sometimes possible for the material contained within the vial of "C1R, Polyclonal Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.