Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23539_WB6.jpg WB (Western Blot) (WB Suggested Anti-C19orf2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit C19orf2 Polyclonal Antibody | anti-URI1 antibody

C19orf2 antibody - middle region

Gene Names
URI1; RMP; URI; NNX3; C19orf2; PPP1R19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C19orf2, Antibody; C19orf2 antibody - middle region; anti-URI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
Sequence Length
495
Applicable Applications for anti-URI1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C19orf2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C19orf2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

product-image-AAA23539_WB6.jpg WB (Western Blot) (WB Suggested Anti-C19orf2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: URI1Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in MCF7)

product-image-AAA23539_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: URI1Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: URI1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23539_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: URI1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: URI1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23539_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: URI1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: URI1Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in HepG2)

product-image-AAA23539_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: URI1Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: URI1Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in HeLa)

product-image-AAA23539_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: URI1Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that URI1 is expressed in HeLa)
Related Product Information for anti-URI1 antibody
This is a rabbit polyclonal antibody against C19orf2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Synonym Full Names
URI1 prefoldin like chaperone
NCBI Official Symbol
URI1
NCBI Official Synonym Symbols
RMP; URI; NNX3; C19orf2; PPP1R19
NCBI Protein Information
unconventional prefoldin RPB5 interactor 1

Similar Products

Product Notes

The URI1 (Catalog #AAA23539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C19orf2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C19orf2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the URI1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGEYVPRKSI LKSRSRENSV CSDTSESSAA EFDDRRGVLR SISCEEATCS. It is sometimes possible for the material contained within the vial of "C19orf2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.