Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-BRD4 Polyclonal Antibody – Cat# AAA198438 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

Bromodomain-Containing Protein 4 Isoform Short (BRD4) Antibody – Rabbit Polyclonal

BRD4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
BRD4; CAP; MCAP; HUNK1; HUNKI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunofluorescence, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
BRD4, Antibody; BRD4 antibody - C-terminal region; anti-BRD4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Sequence Length
722
Applicable Applications for anti-BRD4 antibody
WB (Western Blot), IF (Immunofluorescence), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

Rabbit Anti-BRD4 Polyclonal Antibody – Cat# AAA198438 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

WB (Western Blot)

(Host: RabbitTarget Name: BRD4Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-BRD4 Polyclonal Antibody – Cat# AAA198438 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: BRD4Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IF (Immunofluorescence)

(Sample Type :HeLaPrimary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :BRD4)

Rabbit Anti-BRD4 Polyclonal Antibody – Cat# AAA198438 – IF (Immunofluorescence) IF (Immunofluorescence) (Sample Type :HeLaPrimary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :BRD4)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region and HCT116 Cells)

Rabbit Anti-BRD4 Polyclonal Antibody – Cat# AAA198438 – ChIP (Chromatin Immunoprecipitation) ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region and HCT116 Cells)
Related Product Information for anti-BRD4 antibody
This is a rabbit polyclonal antibody against BRD4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
bromodomain-containing protein 4 isoform short
NCBI Official Synonym Full Names
bromodomain containing 4
NCBI Official Symbol
BRD4
NCBI Official Synonym Symbols
CAP; MCAP; HUNK1; HUNKI
NCBI Protein Information
bromodomain-containing protein 4
UniProt Protein Name
Bromodomain-containing protein 4
UniProt Gene Name
BRD4
UniProt Synonym Gene Names
HUNK1
UniProt Entry Name
BRD4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BRD4 brd4 (Catalog #AAA198438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRD4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BRD4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the BRD4 brd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIEIDFETLK PSTLRELERY VTSCLRKKRK PQAEKVDVIA GSSKMKGFSS. It is sometimes possible for the material contained within the vial of "BRD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.