Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-BOLA2 Polyclonal Antibody – Cat# AAA198193 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Bola2 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)

Bola-Like Protein 2 (BOLA2) Antibody – Rabbit Polyclonal

Bola2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Bola2; BolA-2; 1110025L05Rik
Reactivity
Tested: Mouse; Predicted: Cow, Goat, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Bola2, Antibody; Bola2 antibody - N-terminal region; anti-BOLA2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested: Mouse; Predicted: Cow, Goat, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-BOLA2 antibody
WB (Western Blot)
Protein Size (# AA)
86 amino acids
Peptide Sequence
Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL
Protein Interactions
Eed;
Blocking Peptide
For anti-Bola2 (MBS3203638) antibody is Catalog # MBS3228605
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola2
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Goat: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Replacement Item
This antibody may replace item sc-141724 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Bola2 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)

Rabbit Anti-BOLA2 Polyclonal Antibody – Cat# AAA198193 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Bola2 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)
Related Product Information for anti-BOLA2 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-BOLA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
bolA-like protein 2
NCBI Official Synonym Full Names
bolA-like 2 (E. coli)
NCBI Official Symbol
Bola2
NCBI Official Synonym Symbols
BolA-2; 1110025L05Rik
NCBI Protein Information
bolA-like protein 2
UniProt Protein Name
BolA-like protein 2
UniProt Gene Name
Bola2
UniProt Entry Name
BOLA2_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BOLA2 bola2 (Catalog #AAA198193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bola2 antibody - N-terminal region reacts with Tested: Mouse; Predicted: Cow, Goat, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bola2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BOLA2 bola2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bola2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.