Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-BMP2K Polyclonal Antibody – Cat# AAA199128 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-BMP2K Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

BMP-2-Inducible Protein Kinase Isoform B (BMP2K) Antibody – Rabbit Polyclonal

BMP2K antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
BMP2K; BIKE; HRIHFB2017
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
BMP2K, Antibody; BMP2K antibody - C-terminal region; anti-BMP2K antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
Sequence Length
662
Applicable Applications for anti-BMP2K antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BMP2K
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BMP2K Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit Anti-BMP2K Polyclonal Antibody – Cat# AAA199128 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-BMP2K Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-BMP2K Polyclonal Antibody – Cat# AAA199128 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-BMP2K antibody
This is a rabbit polyclonal antibody against BMP2K. It was validated on Western Blot and immunohistochemistry

Target Description: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation.This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
BMP-2-inducible protein kinase isoform b
NCBI Official Synonym Full Names
BMP2 inducible kinase
NCBI Official Symbol
BMP2K
NCBI Official Synonym Symbols
BIKE; HRIHFB2017
NCBI Protein Information
BMP-2-inducible protein kinase
UniProt Protein Name
Putative uncharacterized protein BMP2K
UniProt Gene Name
BMP2K
UniProt Entry Name
Q4W5H2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BMP2K bmp2k (Catalog #AAA199128) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP2K antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BMP2K can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BMP2K bmp2k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQHQPSQQQA SPEYLTSPQE FSPALVSYTS SLPAQVGTIM DSSYSANRSV. It is sometimes possible for the material contained within the vial of "BMP2K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.