Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23497_APP12.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit BDNF Polyclonal Antibody | anti-BDNF antibody

BDNF antibody - middle region

Gene Names
BDNF; ANON2; BULN2
Reactivity
Tested Species Reactivity: Human, Mouse, Monkey
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
BDNF, Antibody; BDNF antibody - middle region; anti-BDNF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse, Monkey
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Sequence Length
247
Applicable Applications for anti-BDNF antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BDNF
Protein Size (# AA)
247 amino acids
Protein Interactions
UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;
Enhanced Validation
WB
Y
SPR
YCHAROS
Blocking Peptide
For anti-BDNF (AAA23497) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA23497_APP12.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Type: Fetal Liver lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA23497_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Type: Fetal Liver lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA23497_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB9.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BDNFSample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

product-image-AAA23497_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: BDNFSample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: BDNFSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB5.jpg WB (Western Blot) (Host: MouseTarget Name: BDNFSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: BDNFSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB4.jpg WB (Western Blot) (Host: MouseTarget Name: BDNFSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: BDNFSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA23497_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: BDNFSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Ventral horn region of mouse spinal cordPrimary Antibody Dilution :1:200Secondary Antibody :Donkey anti-rabbit CY2Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green:BDNFGene Name :BDNFSubmitted by :Anonymous)

product-image-AAA23497_IHC2.jpg IHC (Immunohistochemistry) (Sample Type :Ventral horn region of mouse spinal cordPrimary Antibody Dilution :1:200Secondary Antibody :Donkey anti-rabbit CY2Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green:BDNFGene Name :BDNFSubmitted by :Anonymous)

IHC (Immunohistochemistry)

(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: BDNFGene Name :BDNFSubmitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)

product-image-AAA23497_IHC.jpg IHC (Immunohistochemistry) (Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: BDNFGene Name :BDNFSubmitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Related Product Information for anti-BDNF antibody
This is a rabbit polyclonal antibody against BDNF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
627
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
Brain-derived neurotrophic factor
NCBI Official Synonym Full Names
brain derived neurotrophic factor
NCBI Official Symbol
BDNF
NCBI Official Synonym Symbols
ANON2; BULN2
NCBI Protein Information
brain-derived neurotrophic factor
UniProt Protein Name
Brain-derived neurotrophic factor
UniProt Gene Name
BDNF
UniProt Synonym Gene Names
BDNF
UniProt Entry Name
BDNF_HUMAN

Similar Products

Product Notes

The BDNF bdnf (Catalog #AAA23497) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BDNF antibody - middle region reacts with Tested Species Reactivity: Human, Mouse, Monkey Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's BDNF can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the BDNF bdnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EWVTAADKKT AVDMSGGTVT VLEKVPVSKG QLKQYFYETK CNPMGYTKEG. It is sometimes possible for the material contained within the vial of "BDNF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.