Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-BAZ2B Polyclonal Antibody – Cat# AAA198435 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DKFZp686H10114Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Bromodomain Adjacent To Zinc Finger Domain Protein 2B Isoform B (BAZ2B) Antibody – Rabbit Polyclonal

BAZ2B Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
BAZ2B; WALp4
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BAZ2B, Antibody; BAZ2B Antibody - middle region; anti-BAZ2B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
LSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKA
Applicable Applications for anti-BAZ2B antibody
WB (Western Blot)
Blocking Peptide
For anti-BAZ2B (MBS3204409) antibody is Catalog # MBS3229376
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BAZ2B
Protein Size (# AA)
441 amino acids
Replacement Item
This antibody may replace item sc-167182 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: DKFZp686H10114Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-BAZ2B Polyclonal Antibody – Cat# AAA198435 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DKFZp686H10114Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BAZ2B antibody
This is a rabbit polyclonal antibody against DKFZp686H10114. It was validated on Western Blot
Product Categories/Family for anti-BAZ2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
bromodomain adjacent to zinc finger domain protein 2B isoform b
NCBI Official Synonym Full Names
bromodomain adjacent to zinc finger domain 2B
NCBI Official Symbol
BAZ2B
NCBI Official Synonym Symbols
WALp4
NCBI Protein Information
bromodomain adjacent to zinc finger domain protein 2B
UniProt Protein Name
Bromodomain adjacent to zinc finger domain protein 2B
UniProt Gene Name
BAZ2B
UniProt Synonym Gene Names
KIAA1476
UniProt Entry Name
BAZ2B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The BAZ2B baz2b (Catalog #AAA198435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAZ2B Antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's BAZ2B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BAZ2B baz2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSTTASSSMG QTKSTSSGGG NRKCNQEQSK NQPLDARVDK IKDKKPRKKA. It is sometimes possible for the material contained within the vial of "BAZ2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.