Copper-Transporting Atpase 1 (ATP7A) Antibody – Rabbit Polyclonal
ATP7A antibody - N-terminal region
Gene Names
ATP7A; MK; MNK; DSMAX; SMAX3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
ATP7A, Antibody; ATP7A antibody - N-terminal region; anti-ATP7A antibody
Product Overview
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Specificity
The immunizing peptide used to raise this antibody is 100% homologous to isoform 3 (503aa 54.3kDa), 1 (1514aa, 165kDa), 2 (1581aa, 172kDa) and 5 (1422aa, 154kDa) of human ATP7A.
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
Sequence Length
1500
Applicable Applications for anti-ATP7A antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ATP7A antibody
This is a rabbit polyclonal antibody against ATP7A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.
Target Description: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.
Product Categories/Family for anti-ATP7A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
163kDa
NCBI Official Full Name
copper-transporting ATPase 1
NCBI Official Synonym Full Names
ATPase copper transporting alpha
NCBI Official Symbol
ATP7A
NCBI Official Synonym Symbols
MK; MNK; DSMAX; SMAX3
NCBI Protein Information
copper-transporting ATPase 1
UniProt Protein Name
Copper-transporting ATPase 1
UniProt Gene Name
ATP7A
UniProt Synonym Gene Names
MC1; MNK
UniProt Entry Name
ATP7A_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The ATP7A atp7a (Catalog #AAA197661) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP7A antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ATP7A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATP7A atp7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKKQIEAMGF PAFVKKQPKY LKLGAIDVER LKNTPVKSSE GSQQRSPSYQ. It is sometimes possible for the material contained within the vial of "ATP7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
