Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Uterus)

V-Type Proton Atpase 116 Kda Subunit A Isoform 1 Isoform 1 (ATP6V0A1) Antibody – Rabbit Polyclonal

Atp6v0a1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Atp6v0a1; Vpp1; Vpp-1; ATP6a1; Atp6n1; Atp6n1a; Atpv0a1; AA959968
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Atp6v0a1, Antibody; Atp6v0a1 antibody - C-terminal region; anti-ATP6V0A1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
Sequence Length
838
Applicable Applications for anti-ATP6V0A1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Horse: 93%; Human: 86%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Uterus)

Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Uterus)

WB (Western Blot)

(Host: RabbitTarget Name: Atp6v0a1Sample Tissue: Mouse Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: Atp6v0a1Sample Tissue: Mouse Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Atp6v0a1Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: Atp6v0a1Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: HelaApplication: Western blottingSpecies+tissue/cell type: HeLa cellsHow many ug'sof tissue/cell lysate run on the gel:1. 10 ug untransfected HeLa lysate2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate3. 10 ug mATP6V0A2-DYKDDDDK transfected HeLa lysate4. 10 ug mATP6V0A1-DYKDDDDK transfected HeLa lysatePrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:1000)

Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – WB (Western Blot) WB (Western Blot) (Sample Type: HelaApplication: Western blottingSpecies+tissue/cell type: HeLa cellsHow many ug'sof tissue/cell lysate run on the gel:1. 10 ug untransfected HeLa lysate2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate3. 10 ug mATP6V0A2-DYKDDDDK transfected HeLa lysate4. 10 ug mATP6V0A1-DYKDDDDK transfected HeLa lysatePrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:1000)

IHC (Immunohistochemistry)

(Sample Type :A. untransfected HeLa cells B. mATP6V0A1 transfected HeLa cellsPrimary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Atp6v0a1: Green DAPI:BlueGene Name :Atp6v0a1 Submitted by :Anonymous)

Rabbit Anti-ATP6V0A1 Polyclonal Antibody – Cat# AAA198177 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :A. untransfected HeLa cells B. mATP6V0A1 transfected HeLa cellsPrimary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Atp6v0a1: Green DAPI:BlueGene Name :Atp6v0a1 Submitted by :Anonymous)
Related Product Information for anti-ATP6V0A1 antibody
This is a rabbit polyclonal antibody against Atp6v0a1. It was validated on Western Blot

Target Description: Atp6v0a1 is required for assembly and activity of the vacuolar ATPase. Atp6v0a1 has a potential role in differential targeting and regulation of the enzyme for a specific organelle.
Product Categories/Family for anti-ATP6V0A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
V-type proton ATPase 116 kDa subunit a isoform 1 isoform 1
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal V0 subunit A1
NCBI Official Symbol
Atp6v0a1
NCBI Official Synonym Symbols
Vpp1; Vpp-1; ATP6a1; Atp6n1; Atp6n1a; Atpv0a1; AA959968
NCBI Protein Information
V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ATP6V0A1 (Catalog #AAA198177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atp6v0a1 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Atp6v0a1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ATP6V0A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLNFGGIRVG NGPTEEDAEI IQHDQLSTHS EDAEEPTEDE VFDFGDTMVH. It is sometimes possible for the material contained within the vial of "Atp6v0a1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.