Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA11658_FCM6.jpg FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing PC-3 cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

anti-Human, Rat ATG14L Polyclonal Antibody | anti-ATG14L antibody

Anti-ATG14L Antibody

Gene Names
ATG14; ATG14L; BARKOR; KIAA0831
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
ATG14L, Antibody; Anti-ATG14L Antibody; Beclin 1-associated autophagy-related key regulator; 4832427M01; ATG14; Atg14L; Autophagy-related protein 14-like protein; BAKOR_HUMAN; Barkor; D14Ertd114e; D14Ertd436e; KIAA0831; mCG_6911; autophagy related 14; anti-ATG14L antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
492
Applicable Applications for anti-ATG14L antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing PC-3 cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11658_FCM6.jpg FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing PC-3 cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of A431 cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing A431 cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11658_FCM5.jpg FCM (Flow Cytometry) (Figure 5. Flow Cytometry analysis of A431 cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing A431 cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing SiHa cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11658_FCM4.jpg FCM (Flow Cytometry) (Figure 4. Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody (AAA11658).Overlay histogram showing SiHa cells stained with AAA11658 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (AAA11658,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of ATG14L using anti-ATG14L antibody (AAA11658). ATG14L was detected in paraffin-embedded section of Human Lung Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ATG14L Antibody (AAA11658) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11658_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of ATG14L using anti-ATG14L antibody (AAA11658). ATG14L was detected in paraffin-embedded section of Human Lung Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ATG14L Antibody (AAA11658) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of ATG14L using anti-ATG14L antibody (AAA11658). ATG14L was detected in paraffin-embedded section of Rat Spleen Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ATG14L Antibody (AAA11658) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11658_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of ATG14L using anti-ATG14L antibody (AAA11658). ATG14L was detected in paraffin-embedded section of Rat Spleen Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ATG14L Antibody (AAA11658) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of ATG14L using anti-ATG14L antibody (AAA11658). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: Rat Brain Tissue Lysate, Lane 2: HELA Whole Cell Lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ATG14L antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ATG14L at approximately 59KD. The expected band size for ATG14L is at 59KD.)

product-image-AAA11658_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of ATG14L using anti-ATG14L antibody (AAA11658). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: Rat Brain Tissue Lysate, Lane 2: HELA Whole Cell Lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ATG14L antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ATG14L at approximately 59KD. The expected band size for ATG14L is at 59KD.)
Related Product Information for anti-ATG14L antibody
Description: Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human;Rat.

Background: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.
References
1. Diao J; Liu R; Rong Y; Zhao M; Zhang J; Lai Y; Zhou Q; Wilz LM; Li J; Vivona S; Pfuetzner RA; Brunger AT; Zhong Q. "ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes". Nature, 2015 Apr 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,434 Da
NCBI Official Full Name
beclin 1-associated autophagy-related key regulator
NCBI Official Synonym Full Names
autophagy related 14
NCBI Official Symbol
ATG14
NCBI Official Synonym Symbols
ATG14L; BARKOR; KIAA0831
NCBI Protein Information
beclin 1-associated autophagy-related key regulator
UniProt Protein Name
Beclin 1-associated autophagy-related key regulator
UniProt Gene Name
ATG14
UniProt Synonym Gene Names
Atg14L
UniProt Entry Name
BAKOR_HUMAN

Similar Products

Product Notes

The ATG14L atg14 (Catalog #AAA11658) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATG14L Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATG14L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the ATG14L atg14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATG14L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.