Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21297_IHC8.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Immunohistochemistry of paraffin-embedded human colon using ARL6 antibody at dilution of 1:100 (x40 lens).)

Rabbit ARL6 Polyclonal Antibody | anti-ARL6 antibody

ARL6 Rabbit anti-Human Polyclonal Antibody

Gene Names
ARL6; BBS3; RP55
Reactivity
Mouse, Rat, Human
Applications
Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
ARL6, Antibody; ARL6 Rabbit anti-Human Polyclonal Antibody; IHC-plus ARL6 Antibody; ARL6; ADP-ribosylation factor-like 6; BBS3; RP55; anti-ARL6 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human ARL6.
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-ARL6 antibody
Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IHC: 1:50-1:100
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 21kDa, while the observed MW by Western blot was 21kDa.
Target
Human ARL6
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human ARL6 (NP_115522.1). MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
Conjugation
Unconjugated
Family
Ras GTPase superfamily IPR001806
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemistry)

(ARL6 Antibody-Immunohistochemistry of paraffin-embedded human colon using ARL6 antibody at dilution of 1:100 (x40 lens).)

product-image-AAA21297_IHC8.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Immunohistochemistry of paraffin-embedded human colon using ARL6 antibody at dilution of 1:100 (x40 lens).)

IHC (Immunohistochemistry)

(ARL6 Antibody-Immunohistochemistry of paraffin-embedded human prostate using ARL6 antibody at dilution of 1:100 (x40 lens).)

product-image-AAA21297_IHC7.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Immunohistochemistry of paraffin-embedded human prostate using ARL6 antibody at dilution of 1:100 (x40 lens).)

IHC (Immunohistchemistry)

(ARL6 Antibody-Immunohistochemistry of paraffin-embedded mouse brain using ARL6 antibody at dilution of 1:100 (x40 lens).)

product-image-AAA21297_IHC6.jpg IHC (Immunohistchemistry) (ARL6 Antibody-Immunohistochemistry of paraffin-embedded mouse brain using ARL6 antibody at dilution of 1:100 (x40 lens).)

IHC (Immunohistochemistry)

(ARL6 Antibody-Immunohistochemistry of paraffin-embedded human liver injury using ARL6 antibody at dilution of 1:100 (x40 lens).)

product-image-AAA21297_IHC5.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Immunohistochemistry of paraffin-embedded human liver injury using ARL6 antibody at dilution of 1:100 (x40 lens).)

IHC (Immunohistochemistry)

(ARL6 Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21297_IHC4.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(ARL6 Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21297_IHC3.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(ARL6 Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21297_IHC2.jpg IHC (Immunohistochemistry) (ARL6 Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(ARL6 Antibody-Western blot blot of extracts of various cell lines, using ARL6 antibody.)

product-image-AAA21297_WB.jpg WB (Western Blot) (ARL6 Antibody-Western blot blot of extracts of various cell lines, using ARL6 antibody.)
Related Product Information for anti-ARL6 antibody
ARL6 antibody is an unconjugated rabbit polyclonal antibody to ARL6 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,960 Da
NCBI Official Full Name
ADP-ribosylation factor-like protein 6
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 6
NCBI Official Symbol
ARL6
NCBI Official Synonym Symbols
BBS3; RP55
NCBI Protein Information
ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein
UniProt Protein Name
ADP-ribosylation factor-like protein 6
UniProt Gene Name
ARL6
UniProt Synonym Gene Names
BBS3
UniProt Entry Name
ARL6_HUMAN

Similar Products

Product Notes

The ARL6 arl6 (Catalog #AAA21297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL6 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IHC: 1:50-1:100 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 21kDa, while the observed MW by Western blot was 21kDa. Researchers should empirically determine the suitability of the ARL6 arl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.