Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-APEH antibody Titration: 1 ug/mLSample Type: Human liver)

Acylamino-Acid-Releasing Enzyme (APEH) Antibody – Rabbit Polyclonal

APEH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
APEH; APH; OPH; AARE; ACPH; D3S48E; D3F15S2; DNF15S2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
APEH, Antibody; APEH antibody - N-terminal region; anti-APEH antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
Sequence Length
732
Applicable Applications for anti-APEH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APEH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APEH antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-APEH antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-APEH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateAPEH is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-APEH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateAPEH is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: APEHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: APEHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: APEHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: APEHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-APEH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-APEH Polyclonal Antibody – Cat# AAA199883 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-APEH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-APEH antibody
This is a rabbit polyclonal antibody against APEH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
327
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
acylamino-acid-releasing enzyme
NCBI Official Synonym Full Names
acylaminoacyl-peptide hydrolase
NCBI Official Symbol
APEH
NCBI Official Synonym Symbols
APH; OPH; AARE; ACPH; D3S48E; D3F15S2; DNF15S2
NCBI Protein Information
acylamino-acid-releasing enzyme
UniProt Protein Name
Acylamino-acid-releasing enzyme
UniProt Gene Name
APEH
UniProt Synonym Gene Names
D3F15S2; D3S48E; DNF15S2; AARE; APH; OPH
UniProt Entry Name
ACPH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The APEH apeh (Catalog #AAA199883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APEH antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's APEH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the APEH apeh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYEDDCFGCL SWSHSETHLL YVAEKKRPKA ESFFQTKALD VSASDDEIAR. It is sometimes possible for the material contained within the vial of "APEH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.