Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-APCS Polyclonal Antibody – Cat# AAA199029 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-APCS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Serum Amyloid P-Component (APCS) Antibody – Rabbit Polyclonal

APCS antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
APCS; SAP; PTX2; HEL-S-92n
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
APCS, Antibody; APCS antibody - N-terminal region; anti-APCS antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Sequence Length
223
Applicable Applications for anti-APCS antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APCS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-APCS Polyclonal Antibody – Cat# AAA199029 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-APCS Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-APCS AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-APCS Polyclonal Antibody – Cat# AAA199029 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-APCS AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-APCS antibody
This is a rabbit polyclonal antibody against APCS. It was validated on Western Blot and immunohistochemistry

Target Description: APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
325
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
serum amyloid P-component
NCBI Official Synonym Full Names
amyloid P component, serum
NCBI Official Symbol
APCS
NCBI Official Synonym Symbols
SAP; PTX2; HEL-S-92n
NCBI Protein Information
serum amyloid P-component
UniProt Protein Name
Serum amyloid P-component
UniProt Gene Name
APCS
UniProt Synonym Gene Names
PTX2; SAP
UniProt Entry Name
SAMP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The APCS apcs (Catalog #AAA199029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APCS antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APCS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the APCS apcs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NFTLCFRAYS DLSRAYSLFS YNTQGRDNEL LVYKERVGEY SLYIGRHKVT. It is sometimes possible for the material contained within the vial of "APCS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.