Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-AMIGO2 Polyclonal Antibody – Cat# AAA200525 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: AMIGO2Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Amphoterin-Induced Protein 2 (AMIGO2) Antibody – Rabbit Polyclonal

AMIGO2 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
AMIGO2; ALI1; DEGA; AMIGO-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AMIGO2, Antibody; AMIGO2 Antibody - N-terminal region; anti-AMIGO2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL
Sequence Length
522
Applicable Applications for anti-AMIGO2 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMIGO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: AMIGO2Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-AMIGO2 Polyclonal Antibody – Cat# AAA200525 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: AMIGO2Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: AMIGO2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

Rabbit Anti-AMIGO2 Polyclonal Antibody – Cat# AAA200525 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: AMIGO2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-AMIGO2 antibody
This is a rabbit polyclonal antibody against AMIGO2. It was validated on Western Blot

Target Description: AMIGO2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3 abd may contribute to signal transduction through its intracellular domain. It also may be required for tumorigenesis of a subset of gastric adenocarcinomas.
Product Categories/Family for anti-AMIGO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
amphoterin-induced protein 2
NCBI Official Synonym Full Names
adhesion molecule with Ig like domain 2
NCBI Official Symbol
AMIGO2
NCBI Official Synonym Symbols
ALI1; DEGA; AMIGO-2
NCBI Protein Information
amphoterin-induced protein 2
UniProt Protein Name
Amphoterin-induced protein 2
UniProt Gene Name
AMIGO2
UniProt Synonym Gene Names
DEGA
UniProt Entry Name
AMGO2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The AMIGO2 amigo2 (Catalog #AAA200525) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMIGO2 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AMIGO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AMIGO2 amigo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSYNRIGLLD SEWIPVSFAK LNTLILRHNN ITSISTGSFS TTPNLKCLDL. It is sometimes possible for the material contained within the vial of "AMIGO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.