Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-AKR1C3 Polyclonal Antibody – Cat# AAA201091 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-AKR1C3 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellAKR1C3 is supported by BioGPS gene expression data to be expressed in COLO205)

Aldo-Keto Reductase Family 1 Member C3 Isoform 1 (AKR1C3) Antibody – Rabbit Polyclonal

AKR1C3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
AKR1C3; DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
AKR1C3, Antibody; AKR1C3 antibody - N-terminal region; anti-AKR1C3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCT
Sequence Length
323
Applicable Applications for anti-AKR1C3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Pig: 92%; Rabbit: 86%; Rat: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AKR1C3 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellAKR1C3 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit Anti-AKR1C3 Polyclonal Antibody – Cat# AAA201091 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-AKR1C3 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellAKR1C3 is supported by BioGPS gene expression data to be expressed in COLO205)

IHC (Immunohistochemistry)

(Rabbit Anti-AKR1C3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-AKR1C3 Polyclonal Antibody – Cat# AAA201091 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-AKR1C3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-AKR1C3 antibody
This is a rabbit polyclonal antibody against AKR1C3. It was validated on Western Blot

Target Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
aldo-keto reductase family 1 member C3 isoform 1
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member C3
NCBI Official Symbol
AKR1C3
NCBI Official Synonym Symbols
DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
NCBI Protein Information
aldo-keto reductase family 1 member C3
UniProt Protein Name
Aldo-keto reductase family 1 member C3
UniProt Gene Name
AKR1C3
UniProt Synonym Gene Names
DDH1; HSD17B5; KIAA0119; PGFS; 17-beta-HSD 5; 3-alpha-HSD type 2; DD-3; DD3; PGFS
UniProt Entry Name
AK1C3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The AKR1C3 akr1c3 (Catalog #AAA201091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1C3 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1C3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AKR1C3 akr1c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PALENSLKKA QLDYVDLYLI HSPMSLKPGE ELSPTDENGK VIFDIVDLCT. It is sometimes possible for the material contained within the vial of "AKR1C3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.