Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-AHSG Polyclonal Antibody – Cat# AAA197669 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-AHSG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Alpha-2-HS-Glycoprotein Isoform 2 Preproprotein (AHSG) Antibody – Rabbit Polyclonal

AHSG antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
AHSG; AHS; A2HS; HSGA; APMR1; FETUA
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AHSG, Antibody; AHSG antibody - N-terminal region; anti-AHSG antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Sequence Length
367
Applicable Applications for anti-AHSG antibody
WB (Western Blot)
Homology
Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AHSG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Rabbit Anti-AHSG Polyclonal Antibody – Cat# AAA197669 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-AHSG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)
Related Product Information for anti-AHSG antibody
This is a rabbit polyclonal antibody against AHSG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
197
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
alpha-2-HS-glycoprotein isoform 2 preproprotein
NCBI Official Synonym Full Names
alpha 2-HS glycoprotein
NCBI Official Symbol
AHSG
NCBI Official Synonym Symbols
AHS; A2HS; HSGA; APMR1; FETUA
NCBI Protein Information
alpha-2-HS-glycoprotein
UniProt Protein Name
Alpha-2-HS-glycoprotein
UniProt Gene Name
AHSG
UniProt Synonym Gene Names
FETUA
UniProt Entry Name
FETUA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The AHSG ahsg (Catalog #AAA197669) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AHSG antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AHSG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AHSG ahsg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQLWGCHSAP HGPGLIYRQP NCDDPETEEA ALVAIDYINQ NLPWGYKHTL. It is sometimes possible for the material contained within the vial of "AHSG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.