Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23545_WB6.jpg WB (Western Blot) (WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACTR1B is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ACTR1B Polyclonal Antibody | anti-ACTR1B antibody

ACTR1B antibody - C-terminal region

Gene Names
ACTR1B; PC3; ARP1B; CTRN2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACTR1B, Antibody; ACTR1B antibody - C-terminal region; anti-ACTR1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
Sequence Length
376
Applicable Applications for anti-ACTR1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACTR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACTR1B is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23545_WB6.jpg WB (Western Blot) (WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACTR1B is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23545_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23545_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23545_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23545_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTR1BSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTR1BSample Type: Human 721_BAntibody Dilution: 1.0ug/mlACTR1B is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23545_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTR1BSample Type: Human 721_BAntibody Dilution: 1.0ug/mlACTR1B is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ACTR1B antibody
This is a rabbit polyclonal antibody against ACTR1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACTR1B is a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex.
Product Categories/Family for anti-ACTR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
beta-centractin
NCBI Official Synonym Full Names
actin related protein 1B
NCBI Official Symbol
ACTR1B
NCBI Official Synonym Symbols
PC3; ARP1B; CTRN2
NCBI Protein Information
beta-centractin
UniProt Protein Name
Beta-centractin
UniProt Gene Name
ACTR1B
UniProt Synonym Gene Names
CTRN2; ARP1B
UniProt Entry Name
ACTY_HUMAN

Similar Products

Product Notes

The ACTR1B actr1b (Catalog #AAA23545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTR1B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACTR1B actr1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIKISAPQER LYSTWIGGSI LASLDTFKKM WVSKKEYEED GSRAIHRKTF. It is sometimes possible for the material contained within the vial of "ACTR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.