Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Alpha-Actinin-1 Isoform B (ACTN1) Antibody – Rabbit Polyclonal

ACTN1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ACTN1; BDPLT15
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACTN1, Antibody; ACTN1 antibody - N-terminal region; anti-ACTN1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
Sequence Length
892
Applicable Applications for anti-ACTN1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 75%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

WB (Western Blot)

(Lanes:Lane1: 10 ug ACTN1-GFP transfected COS-7 lysateLane2: 10 ug ACTN2-GFP transfected COS-7 lysateLane3: 10 ug ACTN3-GFP transfected COS-7 lysateLane4: 10 ug ACTN4-GFP transfected COS-7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACTN1Submitted by:Johannes W. Hell, University of California)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (Lanes:Lane1: 10 ug ACTN1-GFP transfected COS-7 lysateLane2: 10 ug ACTN2-GFP transfected COS-7 lysateLane3: 10 ug ACTN3-GFP transfected COS-7 lysateLane4: 10 ug ACTN4-GFP transfected COS-7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACTN1Submitted by:Johannes W. Hell, University of California)

WB (Western Blot)

(Host: RabbitTarget Name: ACTN1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ACTN1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: Rat Cortical NeuronsACTN1 antibody - N-terminal region validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30ug)2. Rat cortical neurons ACTN1 siRNA (30ug) at 1:1000-1:2000.)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (Sample Type: Rat Cortical NeuronsACTN1 antibody - N-terminal region validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30ug)2. Rat cortical neurons ACTN1 siRNA (30ug) at 1:1000-1:2000.)

WB (Western Blot)

(Sample Type: Human HEK293Sample Type: 1.-4. rACTN1-GFP + HEK293 (50ug)Primary Dilution: 1:1000-1:2000Secondary Antibody: HRP conjugated goat anti-rabbitSecondary Dilution: 1:20,000Image Submitted By: Magdalena KalinowskaAlbert Einstein College of MedicineÂÂ)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – WB (Western Blot) WB (Western Blot) (Sample Type: Human HEK293Sample Type: 1.-4. rACTN1-GFP + HEK293 (50ug)Primary Dilution: 1:1000-1:2000Secondary Antibody: HRP conjugated goat anti-rabbitSecondary Dilution: 1:20,000Image Submitted By: Magdalena KalinowskaAlbert Einstein College of MedicineÂÂ)

IHC (Immunohistochemistry)

(Sample Type :ACTNX-GFP transfected COS-7 cellsPrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-Alexa-Fluor 568Secondary Antibody Dilution :1:100Color/Signal Descriptions :Green: GFP Red: ACTN1Gene Name :ACTN1Submitted by :Johannes W. Hell, Ph.D., Professor, Department of Pharmacology, University of California, Room 2419D Tupper Hall, Davis, CA 95616-5270, Phone: (530) 752 6540, Lab: (530) 752 7551, FAX: (530) 752 7710)

Rabbit Anti-ACTN1 Polyclonal Antibody – Cat# AAA23579 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :ACTNX-GFP transfected COS-7 cellsPrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-Alexa-Fluor 568Secondary Antibody Dilution :1:100Color/Signal Descriptions :Green: GFP Red: ACTN1Gene Name :ACTN1Submitted by :Johannes W. Hell, Ph.D., Professor, Department of Pharmacology, University of California, Room 2419D Tupper Hall, Davis, CA 95616-5270, Phone: (530) 752 6540, Lab: (530) 752 7551, FAX: (530) 752 7710)
Related Product Information for anti-ACTN1 antibody
This is a rabbit polyclonal antibody against ACTN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-ACTN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
87
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
alpha-actinin-1 isoform b
NCBI Official Synonym Full Names
actinin alpha 1
NCBI Official Symbol
ACTN1
NCBI Official Synonym Symbols
BDPLT15
NCBI Protein Information
alpha-actinin-1
UniProt Protein Name
Alpha-actinin-1
UniProt Gene Name
ACTN1
UniProt Entry Name
ACTN1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ACTN1 actn1 (Catalog #AAA23579) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACTN1 actn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHYDSQQTND YMQPEEDWDR DLLLDPAWEK QQRKTFTAWC NSHLRKAGTQ. It is sometimes possible for the material contained within the vial of "ACTN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.