Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ACP1 Polyclonal Antibody – Cat# AAA199100 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateACP1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Low Molecular Weight Phosphotyrosine Protein Phosphatase Isoform B (ACP1) Antibody – Rabbit Polyclonal

ACP1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ACP1; HAAP; LMWPTP; LMW-PTP
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACP1, Antibody; ACP1 antibody - middle region; anti-ACP1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
Sequence Length
158
Applicable Applications for anti-ACP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateACP1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Rabbit Anti-ACP1 Polyclonal Antibody – Cat# AAA199100 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateACP1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

IHC (Immunohistochemistry)

(Rabbit Anti-ACP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: ExtracellularPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-ACP1 Polyclonal Antibody – Cat# AAA199100 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-ACP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: ExtracellularPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ACP1 antibody
This is a rabbit polyclonal antibody against ACP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.
Product Categories/Family for anti-ACP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
52
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18
NCBI Official Full Name
low molecular weight phosphotyrosine protein phosphatase isoform b
NCBI Official Synonym Full Names
acid phosphatase 1
NCBI Official Symbol
ACP1
NCBI Official Synonym Symbols
HAAP; LMWPTP; LMW-PTP
NCBI Protein Information
low molecular weight phosphotyrosine protein phosphatase
UniProt Protein Name
Low molecular weight phosphotyrosine protein phosphatase
UniProt Gene Name
ACP1
UniProt Synonym Gene Names
LMW-PTP; LMW-PTPase
UniProt Entry Name
PPAC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ACP1 acp1 (Catalog #AAA199100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACP1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACP1 acp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NISENWVIDS GAVSDWNVGR SPDPRAVSCL RNHGIHTAHK ARQITKEDFA. It is sometimes possible for the material contained within the vial of "ACP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.