Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ACAT2 Polyclonal Antibody – Cat# AAA197464 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACAT2 Antibody Titration: 2.0ug/mlPositive Control: K562 cell lysateACAT2 is supported by BioGPS gene expression data to be expressed in K562)

Acetyl-Coa Acetyltransferase, Cytosolic Isoform 1 (ACAT2) Antibody – Rabbit Polyclonal

ACAT2 antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ACAT2, Antibody; ACAT2 antibody - middle region; anti-ACAT2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
Sequence Length
397
Applicable Applications for anti-ACAT2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%; Yeast: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACAT2 Antibody Titration: 2.0ug/mlPositive Control: K562 cell lysateACAT2 is supported by BioGPS gene expression data to be expressed in K562)

Rabbit Anti-ACAT2 Polyclonal Antibody – Cat# AAA197464 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ACAT2 Antibody Titration: 2.0ug/mlPositive Control: K562 cell lysateACAT2 is supported by BioGPS gene expression data to be expressed in K562)

IHC (Immunohistochemistry)

(Human Stomach)

Rabbit Anti-ACAT2 Polyclonal Antibody – Cat# AAA197464 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Stomach)
Related Product Information for anti-ACAT2 antibody
This is a rabbit polyclonal antibody against ACAT2. It was validated on Western Blot and immunohistochemistry

Target Description: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Product Categories/Family for anti-ACAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
39
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
acetyl-CoA acetyltransferase, cytosolic isoform 1
NCBI Official Synonym Full Names
acetyl-CoA acetyltransferase 2
NCBI Official Symbol
ACAT2
NCBI Protein Information
acetyl-CoA acetyltransferase, cytosolic

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ACAT2 (Catalog #AAA197464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACAT2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ACAT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACAT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLSQNRTENA QKAGHFDKEI VPVLVSTRKG LIEVKTDEFP RHGSNIEAMS. It is sometimes possible for the material contained within the vial of "ACAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.