Myelin Proteolipid Protein (plp) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Oncorhynchus mykiss Myelin proteolipid protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Oncorhynchus mykiss Myelin proteolipid; N/A; Recombinant Oncorhynchus mykiss Myelin proteolipid protein; DM20 Lipophilin; plp recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
150-218. Partial
Sequence
PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for plp recombinant protein
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
References
Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.7 kDa
NCBI Official Full Name
myelin proteolipid protein
NCBI Official Symbol
plp
NCBI Protein Information
myelin proteolipid protein
UniProt Protein Name
Myelin proteolipid protein
UniProt Gene Name
plp
UniProt Synonym Gene Names
PLP
UniProt Entry Name
MYPR_ONCMY
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The plp plp (Catalog #AAA115929) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 150-218. Partial. The amino acid sequence is listed below: PSSSSLIWHR PATTSTSWTE TTPSINQHGW ICMDARQYGL LPWNAMPGKA CGMTLASICK TKEFFVTYD. It is sometimes possible for the material contained within the vial of "Oncorhynchus mykiss Myelin proteolipid, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
