Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18798_SDS_PAGE.png SDS-PAGE

Putative phospholipase B-like 2 Recombinant Protein | Plbd2 recombinant protein

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Gene Names
Plbd2; P76; AU019810; 1300012G16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative phospholipase B-like 2; N/A; Recombinant Mouse Putative phospholipase B-like 2 (Plbd2); 66.3 kDa protein76 kDa protein; p76LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2; Plbd2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
47-594aa; Full Length of Mature Protein
Sequence
LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18798_SDS_PAGE.png SDS-PAGE
Related Product Information for Plbd2 recombinant protein
Putative phospholipase.
References
Positional cloning of the murine flavivirus resistance gene.Perelygin A.A., Scherbik S.V., Zhulin I.B., Stockman B.M., Li Y., Brinton M.A.Proc. Natl. Acad. Sci. U.S.A. 99:9322-9327(2002) Molecular characterization of the hypothetical 66.3-kDa protein in mouse lysosomal targeting, glycosylation, processing and tissue distribution.Deuschl F., Kollmann K., von Figura K., Luebke T.FEBS Lett. 580:5747-5752(2006) Biochemical characterization and lysosomal localization of the mannose-6-phosphate protein p76 (hypothetical protein LOC196463) .Jensen A.G., Chemali M., Chapel A., Kieffer-Jaquinod S., Jadot M., Garin J., Journet A.Biochem. J. 402:449-458(2007) De novo sulfur SAD phasing of the lysosomal 66.3 kDa protein from mouse.Lakomek K., Dickmanns A., Mueller U., Kollmann K., Deuschl F., Berndt A., Lubke T., Ficner R.Acta Crystallogr. D 65:220-228(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63.9 kDa
NCBI Official Full Name
putative phospholipase B-like 2
NCBI Official Synonym Full Names
phospholipase B domain containing 2
NCBI Official Symbol
Plbd2
NCBI Official Synonym Symbols
P76; AU019810; 1300012G16Rik
NCBI Protein Information
putative phospholipase B-like 2
UniProt Protein Name
Putative phospholipase B-like 2
UniProt Gene Name
Plbd2
UniProt Synonym Gene Names
p76
UniProt Entry Name
PLBL2_MOUSE

Similar Products

Product Notes

The Plbd2 plbd2 (Catalog #AAA18798) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 47-594aa; Full Length of Mature Protein. The amino acid sequence is listed below: LPTLGPGWQR QNPDPPVSRT RSLLLDAASG QLRLEDGFHP DAVAWANLTN AIRETGWAYL DLSTNGRYND SLQAYAAGVV EASVSEELIY MHWMNTVVNY CGPFEYEVGY CEKLKNFLEA NLEWMQREME LNPDSPYWHQ VRLTLLQLKG LEDSYEGRLT FPTGRFTIKP LGFLLLQISG DLEDLEPALN KTNTKPSLGS GSCSALIKLL PGGHDLLVAH NTWNSYQNML RIIKKYRLQF REGPQEEYPL VAGNNLVFSS YPGTIFSGDD FYILGSGLVT LETTIGNKNP ALWKYVQPQG CVLEWIRNVV ANRLALDGAT WADVFKRFNS GTYNNQWMIV DYKAFLPNGP SPGSRVLTIL EQIPGMVVVA DKTAELYKTT YWASYNIPYF ETVFNASGLQ ALVAQYGDWF SYTKNPRAKI FQRDQSLVED MDAMVRLMRY NDFLHDPLSL CEACNPKPNA ENAISARSDL NPANGSYPFQ ALHQRAHGGI DVKVTSFTLA KYMSMLAASG PTWDQCPPFQ WSKSPFHSML HMGQPDLWMF SPIRVPWD . It is sometimes possible for the material contained within the vial of "Putative phospholipase B-like 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.