Urokinase Plasminogen Activator Surface Receptor Isoform 2 (Plaur) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Rat Urokinase plasminogen activator surface receptor
Gene Names
Plaur; Par; uPAR; Plaur3; uPAR-2; uPAR-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urokinase plasminogen activator surface receptor; N/A; Recombinant Rat Urokinase plasminogen activator surface receptor; CD87; Plaur recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-299aa; Full Length of Mature Protein
Sequence
LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Plaur recombinant protein
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
References
Isolation and characterization of multiple isoforms of the rat urokinase receptor in osteoblasts.Rabbani S.A., Rajwans N., Achbarou A., Murthy K.K., Goltzman D.FEBS Lett. 338:69-74(1994) DeYoung M.B., Wohlgemuth J., Dichek D.A. The receptor for the plasminogen activator of urokinase type is up-regulated in transformed rat thyroid cells.Ragno P., Cassano S., Degen J., Kessler C., Blasi F., Rossi G.FEBS Lett. 306:193-198(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.1kDa
NCBI Official Full Name
urokinase plasminogen activator surface receptor isoform 2
NCBI Official Synonym Full Names
plasminogen activator, urokinase receptor
NCBI Official Symbol
Plaur
NCBI Official Synonym Symbols
Par; uPAR; Plaur3; uPAR-2; uPAR-3
NCBI Protein Information
urokinase plasminogen activator surface receptor
UniProt Protein Name
Urokinase plasminogen activator surface receptor
UniProt Gene Name
Plaur
UniProt Synonym Gene Names
U-PAR; uPAR
UniProt Entry Name
UPAR_RAT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Plaur plaur (Catalog #AAA113389) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-299aa; Full Length of Mature Protein. The amino acid sequence is listed below: LRCIQCESNQ DCLVEECALG QDLCRTTVLR EWEDAEELEV VTRGCAHKEK TNRTMSYRMG SVIVSLTETV CATNLCNRPR PGARGRPFPR GRYLECASCT SLDQSCERGR EQSLQCRYPT EHCIEVVTLQ STERSVKDEP YTKGCGSLPG CPGTAGFHSN QTFHFLKCCN FTQCNGGPVL DLQSLPPNGF QCYSCEGNST FGCSYEETSL IDCRGPMNQC LEATGLDVLG NRSYTVRGCA TASWCQGSHV ADSFQTHVNL SISCCNGSGC NRPTG. It is sometimes possible for the material contained within the vial of "Urokinase plasminogen activator surface receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
