Secretory phospholipase A2 receptor (PLA2R1) Recombinant Protein | PLA2R1 recombinant protein

Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial

Cat. Num. AAA117044

• Gene Names: PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Secretory phospholipase A2 receptor (PLA2R1); N/A; Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial; 180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; PLA2R1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 395-530aa; Partial
• Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PLA2R1 recombinant protein

Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function rains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B.

Product Categories/Family for PLA2R1 recombinant protein

Cardiovascular

References

The human 180-kDa receptor for secretory phospholipases A2. Molecular cloning, identification of a secreted soluble form, expression, and chromosomal localization.Ancian P., Lambeau G., Mattei M.-G., Lazdunski M.J. Biol. Chem. 270:8963-8970(1995) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 55953106
• NCBI GeneID: 22925
• NCBI Accession #: NP_001007268.1
• NCBI GenBank Nucleotide #: NM_001007267.2
• UniProt Accession #: Q13018; Q13019; Q15095; Q53R45; Q53RR7; B2RTU9; D3DPB1
• Molecular Weight: 17.4 kDa
• NCBI Official Full Name: secretory phospholipase A2 receptor isoform 2
• NCBI Official Synonym Full Names: phospholipase A2 receptor 1
• NCBI Official Symbol: PLA2R1
• NCBI Official Synonym Symbols: PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
• NCBI Protein Information: secretory phospholipase A2 receptor
• UniProt Protein Name: Secretory phospholipase A2 receptor
• UniProt Gene Name: PLA2R1
• UniProt Synonym Gene Names: CLEC13C; PLA2-R; PLA2R; Soluble PLA2-R; Soluble PLA2R
• UniProt Entry Name: PLA2R_HUMAN