Serine/Threonine-Protein Kinase PAK 1 Isoform 1 (PAK1) E Coli Recombinant Protein
Serine/threonine-protein kinase PAK 1
Gene Names
PAK1; IDDMSSD; PAKalpha
Applications
Western Blot, ELISA
Purity
>90%
Synonyms
PAK1 / Serine/Threonine-Protein Kinase PAK 1; N/A; Serine/threonine-protein kinase PAK 1; Alpha-PAK; p21-activated kinase 1; PAK-1; p65-PAK; PAK1 recombinant protein
Product Overview
Host
E Coli
Purity/Purification
>90%
Form/Format
Liquid; 50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Concentration
1mg/mL; 0.05mg (varies by lot)
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSV
Applicable Applications for PAK1 recombinant protein
WB (Western Blot), ELISA
Organism
Homo sapiens (human)
Preparation and Storage
Store at -20 degree C. (Avoid repeated freezing and thawing.)
Related Product Information for PAK1 recombinant protein
Recombinant protein with His-tag
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22KD
NCBI Official Full Name
serine/threonine-protein kinase PAK 1 isoform 1
NCBI Official Synonym Full Names
p21 (RAC1) activated kinase 1
NCBI Official Symbol
PAK1
NCBI Official Synonym Symbols
IDDMSSD; PAKalpha
NCBI Protein Information
serine/threonine-protein kinase PAK 1
UniProt Protein Name
Serine/threonine-protein kinase PAK 1
UniProt Gene Name
PAK1
UniProt Synonym Gene Names
PAK-1
UniProt Entry Name
PAK1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The PAK1 pak1 (Catalog #AAA196939) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PAK1 / Serine/Threonine-Protein Kinase PAK 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the PAK1 pak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSNNGLDIQD KPPAPPMRNT STMIGAGSKD AGTLNHGSKP LPPNPEEKKK KDRFYRSILP GDKTNKKKEK ERPEISLPSD FEHTIHVGFD AVTGEFTGMP EQWARLLQTS NITKSEQKKN PQAVLDVEFY NSKKTSNSQK YMSFTDKSAE DYNSSNALNV KAVSETPAVP PVSEDEDDDD DDATPPPVIA PRPEHTKSV. It is sometimes possible for the material contained within the vial of "PAK1 / Serine/Threonine-Protein Kinase PAK 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
