Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of VRK2 expression in transfected 293T cell line by VRK2 monoclonal antibody Lane 1: VRK2 transfected lysate (58.1kD). Lane 2: Non-transfected lysate.)

Homo Sapiens Vaccinia Related Kinase 2, Mrna (VRK2) Antibody – Mouse Monoclonal

VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (AP)

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VRK2, Antibody; VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (AP); EC=2.7.11.1; anti-VRK2 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B10
Specificity
Recognizes human VRK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1975
Applicable Applications for anti-VRK2 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa260-360 from human VRK2 (AAH27854) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of VRK2 expression in transfected 293T cell line by VRK2 monoclonal antibody Lane 1: VRK2 transfected lysate (58.1kD). Lane 2: Non-transfected lysate.)

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of VRK2 expression in transfected 293T cell line by VRK2 monoclonal antibody Lane 1: VRK2 transfected lysate (58.1kD). Lane 2: Non-transfected lysate.)

Application Data

(Detection limit for recombinant GST tagged VRK2 is ~1ng/ml as a capture antibody.)

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – Application Data Application Data (Detection limit for recombinant GST tagged VRK2 is ~1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to VRK2 on HeLa cell. [antibody concentration 10ug/ml])

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to VRK2 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western blot analysis of VRK2 over-expressed 293 cell line, cotransfected with VRK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – WB (Western Blot) WB (Western Blot) (Western blot analysis of VRK2 over-expressed 293 cell line, cotransfected with VRK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(VRK2 monoclonal antibody, Western Blot analysis of VRK2 expression in K-562.)

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – WB (Western Blot) WB (Western Blot) (VRK2 monoclonal antibody, Western Blot analysis of VRK2 expression in K-562.)

WB (Western Blot)

(VRK2 monoclonal antibody. Western Blot analysis of VRK2 expression in U-2 OS.)

Mouse Anti-VRK2 Monoclonal Antibody – Cat# AAA24406 – WB (Western Blot) WB (Western Blot) (VRK2 monoclonal antibody. Western Blot analysis of VRK2 expression in U-2 OS.)
Product Categories/Family for anti-VRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens vaccinia related kinase 2, mRNA
NCBI Official Synonym Full Names
VRK serine/threonine kinase 2
NCBI Official Symbol
VRK2
NCBI Protein Information
serine/threonine-protein kinase VRK2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The VRK2 (Catalog #AAA24406) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VRK2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VRK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VRK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.