Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24404_WB2.jpg WB (Western Blot) (Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody Lane 1: USP33 transfected lysate (103.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human USP33 Monoclonal Antibody | anti-USP33 antibody

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (AP)

Gene Names
USP33; VDU1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP33, Antibody; USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (AP); EC=3.4.19.12; anti-USP33 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B5
Specificity
Recognizes human USP33.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4506
Applicable Applications for anti-USP33 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa327-427 from USP33 (NP_055832) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody Lane 1: USP33 transfected lysate (103.3kD). Lane 2: Non-transfected lysate.)

product-image-AAA24404_WB2.jpg WB (Western Blot) (Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody Lane 1: USP33 transfected lysate (103.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA24404_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-USP33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitin specific peptidase 33 (USP33), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ubiquitin specific peptidase 33
NCBI Official Symbol
USP33
NCBI Official Synonym Symbols
VDU1
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 33
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 33
UniProt Gene Name
USP33
UniProt Synonym Gene Names
KIAA1097; VDU1
UniProt Entry Name
UBP33_HUMAN

Similar Products

Product Notes

The USP33 usp33 (Catalog #AAA24404) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP33 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP33 usp33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP33, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.