Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (36.41kD).)

TSC22 Domain Family Protein 3 Isoform 1 (TSC22D3) Antibody – Mouse Monoclonal

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (PE)

Average rating 0.0
No ratings yet
Gene Names
TSC22D3; DIP; GILZ; hDIP; DSIPI; TSC-22R
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSC22D3, Antibody; TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (PE); anti-TSC22D3 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A5
Specificity
Recognizes human TSC22D3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TSC22D3 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (36.41kD).)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (36.41kD).)

Application Data

(Detection limit for recombinant GST tagged TSC22D3 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – Application Data Application Data (Detection limit for recombinant GST tagged TSC22D3 is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of TSC22D3 transfected lysate using TSC22D3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TSC22D3 rabbit polyclonal antibody.)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation of TSC22D3 transfected lysate using TSC22D3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TSC22D3 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell. [antibody concentration 10ug/ml].)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Mouse Anti-TSC22D3 Monoclonal Antibody – Cat# AAA25873 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody. Lane 1: TSC22D3 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TSC22D3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 22 kDa
NCBI Official Full Name
TSC22 domain family protein 3 isoform 1
NCBI Official Synonym Full Names
TSC22 domain family, member 3
NCBI Official Symbol
TSC22D3
NCBI Official Synonym Symbols
DIP; GILZ; hDIP; DSIPI; TSC-22R
NCBI Protein Information
TSC22 domain family protein 3; TSC-22-like protein; TSC-22 related protein; TSC-22-related protein; DSIP-immunoreactive peptide; DSIP-immunoreactive leucine zipper protein; delta sleep-inducing peptide immunoreactor; delta sleep inducing peptide, immunore
UniProt Protein Name
TSC22 domain family protein 3
UniProt Gene Name
TSC22D3
UniProt Synonym Gene Names
DSIPI; GILZ; Protein DIP; hDIP; GILZ; TSC-22R
UniProt Entry Name
T22D3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TSC22D3 tsc22d3 (Catalog #AAA25873) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSC22D3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSC22D3 tsc22d3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSC22D3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.