Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25872_WB7.jpg WB (Western Blot) (TRIM33 monoclonal antibody, Western Blot analysis of TRIM33 expression in Hela NE)

Mouse TRIM33 Monoclonal Antibody | anti-TRIM33 antibody

TRIM33 (E3 Ubiquitin-protein Ligase TRIM33, Ectodermin Homolog, RET-fused Gene 7 Protein, Protein Rfg7, Transcription Intermediary Factor 1-gamma, TIF1-gamma, Tripartite Motif-containing Protein 33, KIAA1113, RFG7, TIF1G) (PE)

Gene Names
TRIM33; ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM33, Antibody; TRIM33 (E3 Ubiquitin-protein Ligase TRIM33, Ectodermin Homolog, RET-fused Gene 7 Protein, Protein Rfg7, Transcription Intermediary Factor 1-gamma, TIF1-gamma, Tripartite Motif-containing Protein 33, KIAA1113, RFG7, TIF1G) (PE); anti-TRIM33 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D1
Specificity
Recognizes human TRIM33. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TRIM33 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1006-1106 from human TRIM33 (NP_056990) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(TRIM33 monoclonal antibody, Western Blot analysis of TRIM33 expression in Hela NE)

product-image-AAA25872_WB7.jpg WB (Western Blot) (TRIM33 monoclonal antibody, Western Blot analysis of TRIM33 expression in Hela NE)

WB (Western Blot)

(TRIM33 monoclonal antibody. Western Blot analysis of TRIM33 expression in 293)

product-image-AAA25872_WB6.jpg WB (Western Blot) (TRIM33 monoclonal antibody. Western Blot analysis of TRIM33 expression in 293)

Application Data

(Detection limit for recombinant GST tagged TRIM33 is ~0.03ng/ml as a capture antibody.)

product-image-AAA25872_APP5.jpg Application Data (Detection limit for recombinant GST tagged TRIM33 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 30ug/ml])

product-image-AAA25872_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 30ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

product-image-AAA25872_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

WB (Western Blot)

(TRIM33 monoclonal antibody. Western Blot analysis of TRIM33 expression in PC-12)

product-image-AAA25872_WB2.jpg WB (Western Blot) (TRIM33 monoclonal antibody. Western Blot analysis of TRIM33 expression in PC-12)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA25872_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-TRIM33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 70; 124 kDa

Observed: 70 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM33 isoform alpha
NCBI Official Synonym Full Names
tripartite motif containing 33
NCBI Official Symbol
TRIM33
NCBI Official Synonym Symbols
ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM33; TIF1-gamma; protein Rfg7; ectodermin homolog; RET-fused gene 7 protein; tripartite motif-containing 33; transcriptional intermediary factor 1 gamma
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM33
UniProt Gene Name
TRIM33
UniProt Synonym Gene Names
KIAA1113; RFG7; TIF1G; Protein Rfg7; TIF1-gamma
UniProt Entry Name
TRI33_HUMAN

Similar Products

Product Notes

The TRIM33 trim33 (Catalog #AAA25872) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM33 (E3 Ubiquitin-protein Ligase TRIM33, Ectodermin Homolog, RET-fused Gene 7 Protein, Protein Rfg7, Transcription Intermediary Factor 1-gamma, TIF1-gamma, Tripartite Motif-containing Protein 33, KIAA1113, RFG7, TIF1G) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM33 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM33 trim33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM33, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.