Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26282_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TIMP2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse TIMP2 Monoclonal Antibody | anti-TIMP2 antibody

TIMP2 (TIMP Metallopeptidase Inhibitor 2, CSC-21K) (Biotin)

Gene Names
TIMP2; DDC8; CSC-21K
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TIMP2, Antibody; TIMP2 (TIMP Metallopeptidase Inhibitor 2, CSC-21K) (Biotin); TIMP Metallopeptidase Inhibitor 2; CSC-21K; anti-TIMP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B11
Specificity
Recognizes TIMP2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
220
Applicable Applications for anti-TIMP2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TIMP2 (AAH52605, 27aa-220aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TIMP2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26282_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TIMP2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TIMP2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26282_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TIMP2 on HeLa cell. [antibody concentration 10 ug/ml])

Application Data

(Detection limit for recombinant GST tagged TIMP2 is approximately 0.3ng/ml as a capture antibody.)

product-image-AAA26282_APP4.jpg Application Data (Detection limit for recombinant GST tagged TIMP2 is approximately 0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

product-image-AAA26282_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

product-image-AAA26282_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

WB (Western Blot)

(TIMP2 monoclonal antibody (M04), clone 5B11 Western Blot analysis of TIMP2 expression in HeLa (Cat # L013V1).)

product-image-AAA26282_WB.jpg WB (Western Blot) (TIMP2 monoclonal antibody (M04), clone 5B11 Western Blot analysis of TIMP2 expression in HeLa (Cat # L013V1).)
Related Product Information for anti-TIMP2 antibody
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq]
Product Categories/Family for anti-TIMP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
TIMP metallopeptidase inhibitor 2
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 2
NCBI Official Symbol
TIMP2
NCBI Official Synonym Symbols
DDC8; CSC-21K
NCBI Protein Information
metalloproteinase inhibitor 2

Similar Products

Product Notes

The TIMP2 (Catalog #AAA26282) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TIMP2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.