Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25955_APP6.jpg Application Data (Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.)

Mouse TCF7L2 Monoclonal Antibody | anti-TCF7L2 antibody

TCF7L2 (Transcription Factor 7-like 2 (T-Cell Specific, HMG-Box), TCF-4, TCF4) (AP)

Gene Names
TCF7L2; TCF4; TCF-4
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TCF7L2, Antibody; TCF7L2 (Transcription Factor 7-like 2 (T-Cell Specific, HMG-Box), TCF-4, TCF4) (AP); Transcription Factor 7-like 2 (T-Cell Specific; HMG-Box); TCF-4; TCF4; anti-TCF7L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A4
Specificity
Recognizes TCF7L2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TCF7L2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TCF7L2 (NP_110383, 490aa-596aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.)

product-image-AAA25955_APP6.jpg Application Data (Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TCF7L2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA25955_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TCF7L2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TCF7L2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA25955_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TCF7L2 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(TCF7L2 monoclonal antibody (M06), clone 3A4 Western Blot analysis of TCF7L2 expression in K-562.)

product-image-AAA25955_WB3.jpg WB (Western Blot) (TCF7L2 monoclonal antibody (M06), clone 3A4 Western Blot analysis of TCF7L2 expression in K-562.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

product-image-AAA25955_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

product-image-AAA25955_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Related Product Information for anti-TCF7L2 antibody
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes.
Product Categories/Family for anti-TCF7L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,884 Da
NCBI Official Full Name
transcription factor 7-like 2 isoform 2
NCBI Official Synonym Full Names
transcription factor 7 like 2
NCBI Official Symbol
TCF7L2
NCBI Official Synonym Symbols
TCF4; TCF-4
NCBI Protein Information
transcription factor 7-like 2

Similar Products

Product Notes

The TCF7L2 (Catalog #AAA25955) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TCF7L2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCF7L2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCF7L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.