Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26106_WB6.jpg WB (Western Blot) (SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7.)

Mouse SMARCD2 Monoclonal Antibody | anti-SMARCD2 antibody

SMARCD2 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 2, BAF60B, CRACD2, PRO2451, Rsc6p) (APC)

Gene Names
SMARCD2; SGD2; Rsc6p; BAF60B; CRACD2; PRO2451
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SMARCD2, Antibody; SMARCD2 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 2, BAF60B, CRACD2, PRO2451, Rsc6p) (APC); SWI/SNF Related; Matrix Associated; Actin Dependent Regulator of chromatin; Subfamily d; Member 2; BAF60B; CRACD2; PRO2451; Rsc6p; anti-SMARCD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B2
Specificity
Recognizes SMARCD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SMARCD2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMARCD2 (NP_003068, 398aa-474aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7.)

product-image-AAA26106_WB6.jpg WB (Western Blot) (SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7.)

WB (Western Blot)

(SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in PC-12.)

product-image-AAA26106_WB5.jpg WB (Western Blot) (SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in PC-12.)

WB (Western Blot)

(SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in NIH/3T3.)

product-image-AAA26106_WB4.jpg WB (Western Blot) (SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in NIH/3T3.)

WB (Western Blot)

(SMARCD2 monoclonal antibody (M02), clone 2B2 Western Blot analysis of SMARCD2 expression in Hela S3 NE (Cat # L013V3).)

product-image-AAA26106_WB3.jpg WB (Western Blot) (SMARCD2 monoclonal antibody (M02), clone 2B2 Western Blot analysis of SMARCD2 expression in Hela S3 NE (Cat # L013V3).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26106_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26106_IF.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SMARCD2 antibody
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-SMARCD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
NCBI Official Symbol
SMARCD2
NCBI Official Synonym Symbols
SGD2; Rsc6p; BAF60B; CRACD2; PRO2451
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
UniProt Gene Name
SMARCD2
UniProt Synonym Gene Names
BAF60B; BAF60B
UniProt Entry Name
SMRD2_HUMAN

Similar Products

Product Notes

The SMARCD2 smarcd2 (Catalog #AAA26106) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMARCD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMARCD2 smarcd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMARCD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.