Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – Application Data Application Data (Detection limit for recombinant GST tagged SMARCB1 is ~0.03ng/ml as a capture antibody.)

SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator Of Chromatin Subfamily B Member 1 Isoform A (SMARCB1) Antibody – Mouse Monoclonal

SMARCB1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily B Member 1, BRG1-associated Factor 47, BAF47, Integrase Interactor 1 Protein, SNF5 Homolog, hSNF5, BAF47, INI1, SNF5L1) (AP)

Average rating 0.0
No ratings yet
Gene Names
SMARCB1; RDT; CSS3; INI1; SNF5; Snr1; BAF47; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMARCB1, Antibody; SMARCB1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily B Member 1, BRG1-associated Factor 47, BAF47, Integrase Interactor 1 Protein, SNF5 Homolog, hSNF5, BAF47, INI1, SNF5L1) (AP); anti-SMARCB1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E10
Specificity
Recognizes human SMARCB1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SMARCB1 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-181 from human SMARCB1 (NP_003064) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SMARCB1 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – Application Data Application Data (Detection limit for recombinant GST tagged SMARCB1 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (Immunoperoxidase of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

WB (Western Blot)

(SMARCB1 monoclonal antibody. Western Blot analysis of SMARCB1 expression in NIH/3T3.)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – WB (Western Blot) WB (Western Blot) (SMARCB1 monoclonal antibody. Western Blot analysis of SMARCB1 expression in NIH/3T3.)

WB (Western Blot)

(SMARCB1 monoclonal antibody. Western Blot analysis of SMARCB1 expression in Raw 264.7.)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – WB (Western Blot) WB (Western Blot) (SMARCB1 monoclonal antibody. Western Blot analysis of SMARCB1 expression in Raw 264.7.)

WB (Western Blot)

(SMARCB1 monoclonal antibody, Western Blot analysis of SMARCB1 expression in Hela NE.)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – WB (Western Blot) WB (Western Blot) (SMARCB1 monoclonal antibody, Western Blot analysis of SMARCB1 expression in Hela NE.)

WB (Western Blot)

(SMARCB1 monoclonal antibody, Western Blot analysis of SMARCB1 expression in PC-12.)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – WB (Western Blot) WB (Western Blot) (SMARCB1 monoclonal antibody, Western Blot analysis of SMARCB1 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Mouse Anti-SMARCB1 Monoclonal Antibody – Cat# AAA24365 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-SMARCB1 antibody
References
1. IGFBP7 Is Not Required for B-RAF-Induced Melanocyte Senescence. Scurr LL, Pupo GM, Becker TM, Lai K, Schrama D, Haferkamp S, Irvine M, Scolyer RA, Mann GJ, Becker JC, Kefford RF, Rizos H.Cell. 2010 May 14;141(4):717-27.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 isoform a
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
NCBI Official Symbol
SMARCB1
NCBI Official Synonym Symbols
RDT; CSS3; INI1; SNF5; Snr1; BAF47; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
UniProt Gene Name
SMARCB1
UniProt Synonym Gene Names
BAF47; INI1; SNF5L1; BAF47; hSNF5
UniProt Entry Name
SNF5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SMARCB1 smarcb1 (Catalog #AAA24365) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMARCB1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily B Member 1, BRG1-associated Factor 47, BAF47, Integrase Interactor 1 Protein, SNF5 Homolog, hSNF5, BAF47, INI1, SNF5L1) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCB1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMARCB1 smarcb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMARCB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.