Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – WB (Western Blot) WB (Western Blot) (SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

Slc25A13 Protein (slc25a13) Antibody – Mouse Monoclonal

SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2)

Average rating 0.0
No ratings yet
Gene Names
slc25a13; ctln2; citrin; aralar2
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC25A13, Antibody; SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2); Anti -SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2); anti-slc25a13 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes human SLC25A13.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA
Applicable Applications for anti-slc25a13 antibody
ELISA, WB (Western Blot), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa2-80 from SLC25A13 (NP_055066) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – WB (Western Blot) WB (Western Blot) (SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

WB (Western Blot)

(Western blot analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – WB (Western Blot) WB (Western Blot) (Western blot analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged SLC25A13 is ~0.3ng/ml as a capture antibody.)

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – Application Data Application Data (Detection limit for recombinant GST tagged SLC25A13 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10ug/ml])

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibodyLane 1: SLC25A13 transfected lysate (74.2kD).Lane 2: Non-transfected lysate.)

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibodyLane 1: SLC25A13 transfected lysate (74.2kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.8kD).)

Mouse Anti-slc25a13 Monoclonal Antibody – Cat# AAA14804 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (34.8kD).)
Related Product Information for anti-slc25a13 antibody
Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Product Categories/Family for anti-slc25a13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
slc25a13 protein
NCBI Official Synonym Full Names
solute carrier family 25 (aspartate/glutamate carrier), member 13
NCBI Official Symbol
slc25a13
NCBI Official Synonym Symbols
ctln2; citrin; aralar2
NCBI Protein Information
solute carrier family 25, member 13; solute carrier family 25, member 13 (citrin)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The slc25a13 (Catalog #AAA14804) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A13 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the slc25a13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AAAKVALTKR ADPAELRTIF LKYASIEKNG EFFMSPNDFV TRYLNIFGES QPNPKTVELL SGVVDQTKDG LISFQEFVA. It is sometimes possible for the material contained within the vial of "SLC25A13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.