Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25834_WB6.jpg WB (Western Blot) (SF3B2 monoclonal antibody. Western Blot analysis of SF3B2 expression in PC-12.)

Mouse SF3B2 Monoclonal Antibody | anti-SF3B2 antibody

SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (PE)

Gene Names
SF3B2; Cus1; SF3b1; SAP145; SF3B145; SF3b150
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SF3B2, Antibody; SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (PE); anti-SF3B2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D2
Specificity
Recognizes human SF3B2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SF3B2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 60ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa592-646 from human SF3B2 (NP_006833) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(SF3B2 monoclonal antibody. Western Blot analysis of SF3B2 expression in PC-12.)

product-image-AAA25834_WB6.jpg WB (Western Blot) (SF3B2 monoclonal antibody. Western Blot analysis of SF3B2 expression in PC-12.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell. [antibody concentration 60ug/ml].)

product-image-AAA25834_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell. [antibody concentration 60ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6ug/ml].)

product-image-AAA25834_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6ug/ml].)

WB (Western Blot)

(SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in NIH/3T3.)

product-image-AAA25834_WB3.jpg WB (Western Blot) (SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in NIH/3T3.)

WB (Western Blot)

(SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in Hela NE.)

product-image-AAA25834_WB2.jpg WB (Western Blot) (SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (32.05kD).)

product-image-AAA25834_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (32.05kD).)
Product Categories/Family for anti-SF3B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
splicing factor 3B subunit 2
NCBI Official Synonym Full Names
splicing factor 3b subunit 2
NCBI Official Symbol
SF3B2
NCBI Official Synonym Symbols
Cus1; SF3b1; SAP145; SF3B145; SF3b150
NCBI Protein Information
splicing factor 3B subunit 2
UniProt Protein Name
High affinity choline transporter 1
UniProt Gene Name
SLC5A7
UniProt Synonym Gene Names
CHT1; CHT
UniProt Entry Name
SC5A7_HUMAN

Similar Products

Product Notes

The SF3B2 slc5a7 (Catalog #AAA25834) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SF3B2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 60ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SF3B2 slc5a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SF3B2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.