Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25988_WB6.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.)

Mouse RNPS1 Monoclonal Antibody | anti-RNPS1 antibody

RNPS1 (RNA Binding Protein S1, Serine-Rich Domain, E5.1, MGC117332) (AP)

Gene Names
RNPS1; E5.1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
RNPS1, Antibody; RNPS1 (RNA Binding Protein S1, Serine-Rich Domain, E5.1, MGC117332) (AP); RNA Binding Protein S1; Serine-Rich Domain; E5.1; MGC117332; anti-RNPS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7G8
Specificity
Recognizes RNPS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
305
Applicable Applications for anti-RNPS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RNPS1 (NP_006702, 158aa-239aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.)

product-image-AAA25988_WB6.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.)

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in human kidney.)

product-image-AAA25988_WB5.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in human kidney.)

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in 293.)

product-image-AAA25988_WB4.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in 293.)

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in PC-12.)

product-image-AAA25988_WB3.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in PC-12.)

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in Raw 264.7.)

product-image-AAA25988_WB2.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in Raw 264.7.)

WB (Western Blot)

(RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.)

product-image-AAA25988_WB.jpg WB (Western Blot) (RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.)
Related Product Information for anti-RNPS1 antibody
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein. [provided by RefSeq]
Product Categories/Family for anti-RNPS1 antibody
References
1. Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance. Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EACell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
RNA-binding protein with serine-rich domain 1 isoform a
NCBI Official Synonym Full Names
RNA binding protein with serine rich domain 1
NCBI Official Symbol
RNPS1
NCBI Official Synonym Symbols
E5.1
NCBI Protein Information
RNA-binding protein with serine-rich domain 1
UniProt Protein Name
RNA-binding protein with serine-rich domain 1
UniProt Gene Name
RNPS1
UniProt Synonym Gene Names
LDC2
UniProt Entry Name
RNPS1_HUMAN

Similar Products

Product Notes

The RNPS1 rnps1 (Catalog #AAA25988) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RNPS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNPS1 rnps1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNPS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.