Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25815_WB7.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Mouse RBM9 Monoclonal Antibody | anti-RBM9 antibody

RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA) (PE)

Gene Names
RBFOX2; RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM9, Antibody; RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA) (PE); anti-RBM9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human RBM9. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RBM9 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from RBM9 (AAH13115) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

product-image-AAA25815_WB7.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)

WB (Western Blot)

(RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

product-image-AAA25815_WB6.jpg WB (Western Blot) (RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

WB (Western Blot)

(Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25815_WB5.jpg WB (Western Blot) (Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25815_APP4.jpg Application Data (Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA25815_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

product-image-AAA25815_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody Lane 1: RBM9 transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)

product-image-AAA25815_WB.jpg WB (Western Blot) (Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody Lane 1: RBM9 transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-RBM9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
41KD
NCBI Official Full Name
Homo sapiens RNA binding motif protein 9, mRNA
NCBI Official Synonym Full Names
RNA binding fox-1 homolog 2
NCBI Official Symbol
RBFOX2
NCBI Official Synonym Symbols
RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
NCBI Protein Information
RNA binding protein fox-1 homolog 2

Similar Products

Product Notes

The RBM9 (Catalog #AAA25815) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBM9 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.