Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25214_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse anti-Human PPM1B Monoclonal Antibody | anti-PPM1B antibody

PPM1B (Protein Phosphatase 1B, PP2C-beta, Protein Phosphatase 2C Isoform beta, PP2CB, MGC21657) (FITC)

Gene Names
PPM1B; PP2CB; PP2CBETA; PP2C-beta; PPC2BETAX; PP2C-beta-X
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPM1B, Antibody; PPM1B (Protein Phosphatase 1B, PP2C-beta, Protein Phosphatase 2C Isoform beta, PP2CB, MGC21657) (FITC); anti-PPM1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A3-2A4
Specificity
Recognizes human PPM1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PPM1B antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-192 from human PPM1B (AAH12002) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25214_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

WB (Western Blot)

(Western blot analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with PPM1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25214_WB5.jpg WB (Western Blot) (Western blot analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with PPM1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

IP (Immunoprecipitation)

(Immunoprecipitation of PPM1B transfected lysate using PPM1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPM1B monoclonal antibody.)

product-image-AAA25214_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of PPM1B transfected lysate using PPM1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPM1B monoclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA25214_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody. Lane 1: PPM1B transfected lysate (52.643kD). Lane 2: Non-transfected lysate.)

product-image-AAA25214_WB2.jpg WB (Western Blot) (Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody. Lane 1: PPM1B transfected lysate (52.643kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (46.86kD).)

product-image-AAA25214_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (46.86kD).)
Product Categories/Family for anti-PPM1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36,313 Da
NCBI Official Full Name
Homo sapiens protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform, mRNA
NCBI Official Synonym Full Names
protein phosphatase, Mg2+/Mn2+ dependent 1B
NCBI Official Symbol
PPM1B
NCBI Official Synonym Symbols
PP2CB; PP2CBETA; PP2C-beta; PPC2BETAX; PP2C-beta-X
NCBI Protein Information
protein phosphatase 1B

Similar Products

Product Notes

The PPM1B (Catalog #AAA25214) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPM1B (Protein Phosphatase 1B, PP2C-beta, Protein Phosphatase 2C Isoform beta, PP2CB, MGC21657) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPM1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPM1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPM1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.