Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – Application Data Application Data (Detection limit for recombinant GST tagged PCMT1 is ~0.1ng/ml as a capture antibody.)

Protein-L-Isoaspartate(D-Aspartate) O-Methyltransferase Isoform 1 (PCMT1) Antibody – Mouse Monoclonal

PCMT1 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase, PIMT, Protein-beta-Aspartate Methyltransferase, Protein L-isoaspartyl/D-aspartyl Methyltransferase, L-isoaspartyl Protein Carboxyl Methyltransferase) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
PCMT1; PIMT
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCMT1, Antibody; PCMT1 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase, PIMT, Protein-beta-Aspartate Methyltransferase, Protein L-isoaspartyl/D-aspartyl Methyltransferase, L-isoaspartyl Protein Carboxyl Methyltransferase) (Biotin); anti-PCMT1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D6
Specificity
Recognizes human PCMT1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PCMT1 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa117-226 from human PCMT1 (NP_005380) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PCMT1 is ~0.1ng/ml as a capture antibody.)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – Application Data Application Data (Detection limit for recombinant GST tagged PCMT1 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in NIH/3T3.)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – WB (Western Blot) WB (Western Blot) (PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in NIH/3T3.)

WB (Western Blot)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in Raw 264.7.)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – WB (Western Blot) WB (Western Blot) (PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in Raw 264.7.)

WB (Western Blot)

(PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in PC-12.)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – WB (Western Blot) WB (Western Blot) (PCMT1 monoclonal antibody. Western Blot analysis of PCMT1 expression in PC-12.)

WB (Western Blot)

(PCMT1 monoclonal antibody Western Blot analysis of PCMT1 expression in HeLa.)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – WB (Western Blot) WB (Western Blot) (PCMT1 monoclonal antibody Western Blot analysis of PCMT1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.73kD).)

Mouse Anti-PCMT1 Monoclonal Antibody – Cat# AAA24895 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.73kD).)
Related Product Information for anti-PCMT1 antibody
Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form. [supplied by OMIM]
Product Categories/Family for anti-PCMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 1
NCBI Official Synonym Full Names
protein-L-isoaspartate (D-aspartate) O-methyltransferase
NCBI Official Symbol
PCMT1
NCBI Official Synonym Symbols
PIMT
NCBI Protein Information
protein-L-isoaspartate(D-aspartate) O-methyltransferase
UniProt Protein Name
Protein-L-isoaspartate(D-aspartate) O-methyltransferase
UniProt Gene Name
PCMT1
UniProt Synonym Gene Names
PIMT
UniProt Entry Name
PIMT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PCMT1 pcmt1 (Catalog #AAA24895) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCMT1 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase, PIMT, Protein-beta-Aspartate Methyltransferase, Protein L-isoaspartyl/D-aspartyl Methyltransferase, L-isoaspartyl Protein Carboxyl Methyltransferase) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCMT1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCMT1 pcmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCMT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.