Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14779_WB6.jpg WB (Western Blot) (MKRN2 monoclonal antibody Western Blot analysis of MKRN2 expression in Hela NE.)

Mouse anti-Human MKRN2 Monoclonal Antibody

MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070)

Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MKRN2, Antibody; MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070); Anti -MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070); anti-MKRN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F8
Specificity
Recognizes human MKRN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSE*
Applicable Applications for anti-MKRN2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa317-416 from MKRN2 (NP_054879) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(MKRN2 monoclonal antibody Western Blot analysis of MKRN2 expression in Hela NE.)

product-image-AAA14779_WB6.jpg WB (Western Blot) (MKRN2 monoclonal antibody Western Blot analysis of MKRN2 expression in Hela NE.)

WB (Western Blot)

(Western blot analysis of MKRN2 over-expressed 293 cell line, cotransfected with MKRN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MKRN2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA14779_WB5.jpg WB (Western Blot) (Western blot analysis of MKRN2 over-expressed 293 cell line, cotransfected with MKRN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MKRN2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged MKRN2 is ~0.1ng/ml as a capture antibody.)

product-image-AAA14779_APP4.jpg Application Data (Detection limit for recombinant GST tagged MKRN2 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MKRN2 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA14779_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MKRN2 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 monoclonal antibody.Lane 1: MKRN2 transfected lysate (46.9kD).Lane 2: Non-transfected lysate.)

product-image-AAA14779_WB2.jpg WB (Western Blot) (Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 monoclonal antibody.Lane 1: MKRN2 transfected lysate (46.9kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

product-image-AAA14779_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-MKRN2 antibody
The basic function of MKRN2 is mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination. Makorin RING zinc finger-2 (MKRN2), overlaps and is antisense to the gene RAF1 in mammals. Northern blot analyses show that human MKRN2 and RAF1 are co-expressed in tissues and cell lines, raising the possibility of mRNA duplex formation. The encoded makorin-2 protein is likely a ribonucleoprotein of unknown function, but its conservation suggests an important cellular role.
Product Categories/Family for anti-MKRN2 antibody

Similar Products

Product Notes

The MKRN2 (Catalog #AAA14779) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MKRN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the MKRN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFKQGMGKKA CKYFEQGKGT CPFGSKCLYR HAYPDGRLAE PEKPRKQLSS QGTVRFFNSV RLWDFIENRE SRHVPNNEDV DMTELGDLFM HLSGVESSE*. It is sometimes possible for the material contained within the vial of "MKRN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.