Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – WB (Western Blot) WB (Western Blot) (LETM1 monoclonal antibody Western Blot analysis of LETM1 expression in HeLa.)

LETM1 And EF-Hand Domain-Containing Protein 1, Mitochondrial (LETM1) Antibody – Mouse Monoclonal

LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1)

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial, Antibody; LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1); Anti -LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1); anti-LETM1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F7
Specificity
Recognizes human LETM1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
Applicable Applications for anti-LETM1 antibody
ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa601-708 from human LETM1 (NP_036450) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(LETM1 monoclonal antibody Western Blot analysis of LETM1 expression in HeLa.)

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – WB (Western Blot) WB (Western Blot) (LETM1 monoclonal antibody Western Blot analysis of LETM1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.62kD).)

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.62kD).)

Application Data

(Detection limit for recombinant GST tagged LETM1 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – Application Data Application Data (Detection limit for recombinant GST tagged LETM1 is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of LETM1 transfected lysate using LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.)

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation of LETM1 transfected lysate using LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to LETM1 on HeLa cell. [antibody concentration 10ug/ml])

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to LETM1 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody.Lane 1: LETM1 transfected lysate (83.4kD).Lane 2: Non-transfected lysate.)

Mouse Anti-LETM1 Monoclonal Antibody – Cat# AAA14784 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody.Lane 1: LETM1 transfected lysate (83.4kD).Lane 2: Non-transfected lysate.)
Related Product Information for anti-LETM1 antibody
LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) contains 2 EF-hand calcium-binding sites, a transmembrane domain, a leucine zipper motif and several coiled-coil domains. Crucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain. Required for the maintenance of the tubular shape and cristae organization. There are three isoforms.
Product Categories/Family for anti-LETM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
83,354 Da
NCBI Official Full Name
LETM1 and EF-hand domain-containing protein 1, mitochondrial
NCBI Official Synonym Full Names
leucine zipper-EF-hand containing transmembrane protein 1
NCBI Official Symbol
LETM1
NCBI Protein Information
LETM1 and EF-hand domain-containing protein 1, mitochondrial; Mdm38 homolog; leucine zipper-EF-hand-containing transmembrane protein 1
UniProt Protein Name
LETM1 and EF-hand domain-containing protein 1, mitochondrial
UniProt Gene Name
LETM1
UniProt Entry Name
LETM1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LETM1 letm1 (Catalog #AAA14784) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the LETM1 letm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESKASKRLTK RVQQMIGQID GLISQLEMDQ QAGKLAPANG MPTGENVISV AELINAMKQV KHIPESKLTS LAAALDENKD GKVNIDDLVK VIELVDKEDV HISTSQVA. It is sometimes possible for the material contained within the vial of "LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.