Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28462_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug KLF4 Rabbit mAb (AAA28462). Western blot was performed from the immunoprecipitate using KLF4 Rabbit mAb (AAA28462) at a dilution of 1:1000.)

Rabbit anti-Human KLF4 Monoclonal Antibody | anti-KLF4 antibody

KLF4 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
KLF4, Antibody; KLF4 Rabbit mAb; EZF; GKLF; KLF4; anti-KLF4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPL
Applicable Applications for anti-KLF4 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:2000
IHC-P: 1:200-1:2000
IF/ICC: 1:100-1:1000
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KLF4 (O43474).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug KLF4 Rabbit mAb (AAA28462). Western blot was performed from the immunoprecipitate using KLF4 Rabbit mAb (AAA28462) at a dilution of 1:1000.)

product-image-AAA28462_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug KLF4 Rabbit mAb (AAA28462). Western blot was performed from the immunoprecipitate using KLF4 Rabbit mAb (AAA28462) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of U-2 OS cells using KLF4 Rabbit mAb (AAA28462,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

product-image-AAA28462_ICC7.jpg ICC (Immunocytochemistry) (Confocal imaging of U-2 OS cells using KLF4 Rabbit mAb (AAA28462,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse kidney using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28462_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse kidney using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28462_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28462_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28462_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon using KLF4 Rabbit mAb (AAA28462) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse lung, using KLF4 Rabbit mAb (AAA28462) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA28462_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse lung, using KLF4 Rabbit mAb (AAA28462) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using KLF4 Rabbit mAb (AAA28462) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28462_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using KLF4 Rabbit mAb (AAA28462) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-KLF4 antibody
This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 55kDa
Observed MW: 55kDa
UniProt Protein Name
Krueppel-like factor 4
UniProt Gene Name
KLF4
UniProt Synonym Gene Names
EZF; GKLF
UniProt Entry Name
KLF4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KLF4 klf4 (Catalog #AAA28462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF4 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:2000 IHC-P: 1:200-1:2000 IF/ICC: 1:100-1:1000 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the KLF4 klf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAAHDFPLGR QLPSRTTPTL GLEEVLSSRD CHPALPLPPG FHPHPGPNYP SFLPDQMQPQ VPPLHYQGQS RGFVARAGEP CVCWPHFGTH GMMLTPPSSP L. It is sometimes possible for the material contained within the vial of "KLF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.