Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Rat spleen using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Antigen KI-67 (MKI67) Antibody – Rabbit Monoclonal

Ki67 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
Ki67, Antibody; Ki67 Rabbit mAb; KIA; MIB-; MIB-1; PPP1R105; Ki67; anti-MKI67 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK
Applicable Applications for anti-MKI67 antibody
IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Ki67 (NP_002408.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Rat spleen using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Rat spleen using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Mouse spleen using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse spleen using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (AAA28548) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human appendix using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.)

Rabbit Anti-MKI67 Monoclonal Antibody – Cat# AAA28548 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human appendix using Ki67 Rabbit mAb (AAA28548) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.)
Related Product Information for anti-MKI67 antibody
Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 359kDa
UniProt Protein Name
Antigen KI-67
UniProt Gene Name
MKI67
UniProt Entry Name
KI67_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The MKI67 mki67 (Catalog #AAA28548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ki67 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ki67 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the MKI67 mki67 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAGTLPGSKR QLQTPKEKAQ ALEDLAGFKE LFQTPGHTEE LVAAGKTTKI PCDSPQSDPV DTPTSTKQRP KRSIRKADVE GELLACRNLM PSAGKAMHTP K. It is sometimes possible for the material contained within the vial of "Ki67, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.