Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug hnRNP A1 antibody (AAA28461). Western blot was performed from the immunoprecipitate using hnRNP A1 antibody (AAA28461) at a dilution of 1:1000.)

Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1) Antibody – Rabbit Monoclonal

hnRNP A1 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
hnRNP A1, Antibody; hnRNP A1 Rabbit mAb; UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1; anti-HNRNPA1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
Applicable Applications for anti-HNRNPA1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:2000
IHC-P: 1:200-1:2000
IF/ICC: 1:200-1:2000
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human hnRNP A1 (P09651).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug hnRNP A1 antibody (AAA28461). Western blot was performed from the immunoprecipitate using hnRNP A1 antibody (AAA28461) at a dilution of 1:1000.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug hnRNP A1 antibody (AAA28461). Western blot was performed from the immunoprecipitate using hnRNP A1 antibody (AAA28461) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of C6 cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of C6 cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of NIH/3T3 cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of U-2 OS cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of U-2 OS cells using hnRNP A1 Rabbit mAb (AAA28461,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon using hnRNP A1 Rabbit mAb (AAA28461) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon using hnRNP A1 Rabbit mAb (AAA28461) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using hnRNP A1 Rabbit mAb (AAA28461) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using hnRNP A1 Rabbit mAb (AAA28461) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using hnRNP A1 Rabbit mAb (AAA28461) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit Anti-HNRNPA1 Monoclonal Antibody – Cat# AAA28461 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using hnRNP A1 Rabbit mAb (AAA28461) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-HNRNPA1 antibody
This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.hnRNP A1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.
Product Categories/Family for anti-HNRNPA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 39kDa
Observed MW: 30kDa/34kDa/39kDa
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A1
UniProt Gene Name
HNRNPA1
UniProt Synonym Gene Names
HNRPA1; hnRNP A1
UniProt Entry Name
ROA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HNRNPA1 hnrnpa1 (Catalog #AAA28461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The hnRNP A1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's hnRNP A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:2000 IHC-P: 1:200-1:2000 IF/ICC: 1:200-1:2000 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the HNRNPA1 hnrnpa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DGGYGGGGPG YSGGSRGYGS GGQGYGNQGS GYGGSGSYDS YNNGGGGGFG GGSGSNFGGG GSYNDFGNYN NQSSNFGPMK GGNFGGRSSG PYGGGGQYFA K. It is sometimes possible for the material contained within the vial of "hnRNP A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.