Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25122_APP7.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse anti-Human HCLS1 Monoclonal Antibody | anti-HCLS1 antibody

HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (FITC)

Gene Names
HCLS1; HS1; p75; CTTNL; lckBP1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HCLS1, Antibody; HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (FITC); anti-HCLS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes human HCLS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HCLS1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa266-355 from human HCLS1 (AAH16758) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA25122_APP7.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

WB (Western Blot)

(Western blot analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25122_WB6.jpg WB (Western Blot) (Western blot analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged HCLS1 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25122_APP5.jpg Application Data (Detection limit for recombinant GST tagged HCLS1 is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

product-image-AAA25122_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody. Lane 1: HCLS1 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

product-image-AAA25122_WB3.jpg WB (Western Blot) (Western Blot analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody. Lane 1: HCLS1 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(HCLS1 monoclonal antibody Western Blot analysis of HCLS1 expression in K-562.)

product-image-AAA25122_WB2.jpg WB (Western Blot) (HCLS1 monoclonal antibody Western Blot analysis of HCLS1 expression in K-562.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.64kD).)

product-image-AAA25122_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.64kD).)
Product Categories/Family for anti-HCLS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,008 Da
NCBI Official Full Name
Homo sapiens hematopoietic cell-specific Lyn substrate 1, mRNA
NCBI Official Synonym Full Names
hematopoietic cell-specific Lyn substrate 1
NCBI Official Symbol
HCLS1
NCBI Official Synonym Symbols
HS1; p75; CTTNL; lckBP1
NCBI Protein Information
hematopoietic lineage cell-specific protein

Similar Products

Product Notes

The HCLS1 (Catalog #AAA25122) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HCLS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HCLS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HCLS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.