Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – WB (Western Blot) WB (Western Blot) (Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Glutathione Reductase, Mitochondrial Isoform 1 (GSR) Antibody – Mouse Monoclonal

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (FITC)

Average rating 0.0
No ratings yet
Gene Names
GSR; HEL-75; HEL-S-122m
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSR, Antibody; GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (FITC); anti-GSR antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B4
Specificity
Recognizes human GSR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-GSR antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – WB (Western Blot) WB (Western Blot) (Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – Application Data Application Data (Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

WB (Western Blot)

(Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – WB (Western Blot) WB (Western Blot) (GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

Mouse Anti-GSR Monoclonal Antibody – Cat# AAA25118 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.84kD).)
Product Categories/Family for anti-GSR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,267 Da
NCBI Official Full Name
glutathione reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutathione-disulfide reductase
NCBI Official Symbol
GSR
NCBI Official Synonym Symbols
HEL-75; HEL-S-122m
NCBI Protein Information
glutathione reductase, mitochondrial
UniProt Protein Name
Glutathione reductase, mitochondrial
UniProt Gene Name
GSR
UniProt Synonym Gene Names
GLUR; GRD1; GR; GRase
UniProt Entry Name
GSHR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GSR gsr (Catalog #AAA25118) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSR can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSR gsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.