Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19695_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of HepG2 cells using anti-Grp75 antibody (AAA19695).Overlay histogram showing HepG2 cells stained with AAA19695 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Grp75 Antibody (AAA19695, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse Grp75 Monoclonal Antibody | anti-HSPA9 antibody

Anti-Grp75 Antibody Picoband (monoclonal, 4I9)

Gene Names
HSPA9; CSA; MOT; MOT2; CRP40; GRP75; PBP74; GRP-75; HSPA9B; MTHSP75; HEL-S-124m
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Grp75, Antibody; Anti-Grp75 Antibody Picoband (monoclonal, 4I9); anti-HSPA9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Clone Number
4I9
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-HSPA9 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Mouse, Rat
IHC-P: 2-5 ug/ml, Human
ICC/IF: 5 ug/ml, Human
FC/FACS: 1-3 ug/1x10^6 cells, Human
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of HepG2 cells using anti-Grp75 antibody (AAA19695).Overlay histogram showing HepG2 cells stained with AAA19695 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Grp75 Antibody (AAA19695, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19695_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of HepG2 cells using anti-Grp75 antibody (AAA19695).Overlay histogram showing HepG2 cells stained with AAA19695 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Grp75 Antibody (AAA19695, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 6. IF analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in an immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19695_IF6.jpg IF (Immunofluorescence) (Figure 6. IF analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in an immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human lymphadenoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19695_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human lymphadenoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human gall bladder adenosquamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19695_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human gall bladder adenosquamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19695_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human appendiceal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19695_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Grp75 using anti-Grp75 antibody (AAA19695).Grp75 was detected in a paraffin-embedded section of human appendiceal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Grp75 Antibody (AAA19695) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Grp75 using anti-Grp75 antibody (AAA19695).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human HepG2 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat lung tissue lysates,Lane 5: rat PC-12 whole cell lysates,Lane 6: mouse brain tissue lysates,Lane 7: mouse lung tissue lysates,Lane 8: mouse RAW264.7 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Grp75 antigen affinity purified monoclonal antibody (#AAA19695) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Grp75 at approximately 74 kDa. The expected band size for Grp75 is at 74 kDa.)

product-image-AAA19695_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of Grp75 using anti-Grp75 antibody (AAA19695).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human HepG2 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat lung tissue lysates,Lane 5: rat PC-12 whole cell lysates,Lane 6: mouse brain tissue lysates,Lane 7: mouse lung tissue lysates,Lane 8: mouse RAW264.7 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Grp75 antigen affinity purified monoclonal antibody (#AAA19695) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Grp75 at approximately 74 kDa. The expected band size for Grp75 is at 74 kDa.)
Related Product Information for anti-HSPA9 antibody
HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
Product Categories/Family for anti-HSPA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
679
NCBI Official Full Name
Stress-70 protein, mitochondrial
NCBI Official Synonym Full Names
heat shock 70kDa protein 9 (mortalin)
NCBI Official Symbol
HSPA9
NCBI Official Synonym Symbols
CSA; MOT; MOT2; CRP40; GRP75; PBP74; GRP-75; HSPA9B; MTHSP75; HEL-S-124m
NCBI Protein Information
stress-70 protein, mitochondrial; mortalin-2; p66-mortalin; mortalin, perinuclear; heat shock 70kD protein 9B; peptide-binding protein 74; 75 kDa glucose-regulated protein; catecholamine-regulated protein 40; epididymis secretory sperm binding protein Li
UniProt Protein Name
Stress-70 protein, mitochondrial
UniProt Gene Name
HSPA9
UniProt Synonym Gene Names
GRP75; HSPA9B; mt-HSP70; GRP-75; MOT; PBP74
UniProt Entry Name
GRP75_HUMAN

Similar Products

Product Notes

The HSPA9 hspa9 (Catalog #AAA19695) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Grp75 Antibody Picoband (monoclonal, 4I9) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Grp75 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS). WB: 0.25-0.5 ug/ml, Human, Mouse, Rat IHC-P: 2-5 ug/ml, Human ICC/IF: 5 ug/ml, Human FC/FACS: 1-3 ug/1x10^6 cells, Human Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC. Researchers should empirically determine the suitability of the HSPA9 hspa9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Grp75, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.