Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24039_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human Geminin Monoclonal Antibody | anti-GMNN antibody

Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3)

Gene Names
GMNN; Gem
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Geminin, Antibody; Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3); Anti -Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3); anti-GMNN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes human GMNN.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Applicable Applications for anti-GMNN antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa110-209 from human GMNN (AAH05185) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

product-image-AAA24039_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)

Application Data

(Detection limit for recombinant GST tagged GMNN is ~0.03ng/ml as a capture antibody.)

product-image-AAA24039_APP5.jpg Application Data (Detection limit for recombinant GST tagged GMNN is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to GMNN on HeLa cell . [antibody concentration 10ug/ml].)

product-image-AAA24039_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to GMNN on HeLa cell . [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml].)

product-image-AAA24039_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

product-image-AAA24039_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody.Lane 1: GMNN transfected lysate (23.6kD).Lane 2: Non-transfected lysate.)

product-image-AAA24039_WB.jpg WB (Western Blot) (Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody.Lane 1: GMNN transfected lysate (23.6kD).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GMNN antibody
Geminin inhibits DNA replication by preventing the incorporation of MCM complex into the prereplication complex (pre-RC). It is absent during the G1 phase, accumulates during the S, G2, and M phases, and disappears during the metaphase-anaphase transition. Geminin contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
Product Categories/Family for anti-GMNN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,565 Da
NCBI Official Full Name
geminin
NCBI Official Synonym Full Names
geminin, DNA replication inhibitor
NCBI Official Symbol
GMNN
NCBI Official Synonym Symbols
Gem
NCBI Protein Information
geminin
UniProt Protein Name
Geminin
UniProt Gene Name
GMNN
UniProt Entry Name
GEMI_HUMAN

Similar Products

Product Notes

The GMNN gmnn (Catalog #AAA24039) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Geminin can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the GMNN gmnn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LYEALKENEK LHKEIEQKDN EIARLKKENK ELAEVAEHVQ YMAELIERLN GEPLDNFESL DNQEFDSEEE TVEDSLVEDS EIGTCAEGTV SSSTDAKPCI. It is sometimes possible for the material contained within the vial of "Geminin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.