Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – WB (Western Blot) WB (Western Blot) (DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in HeLa.)

Dnaj Homolog Subfamily C Member 10 Isoform 2 (DNAJC10) Antibody – Mouse Monoclonal

DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (HRP)

Average rating 0.0
No ratings yet
Gene Names
DNAJC10; JPDI; MTHr; ERdj5; PDIA19
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNAJC10, Antibody; DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (HRP); anti-DNAJC10 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C4
Specificity
Recognizes human DNAJC10. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DNAJC10 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa688-794 from human DNAJC10 (NP_061854) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in HeLa.)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – WB (Western Blot) WB (Western Blot) (DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in HeLa.)

WB (Western Blot)

(DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in Raw 264.7.)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – WB (Western Blot) WB (Western Blot) (DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in Raw 264.7.)

Application Data

(Detection limit for recombinant GST tagged DNAJC10 is ~10ng/ml as a capture antibody.)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – Application Data Application Data (Detection limit for recombinant GST tagged DNAJC10 is ~10ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

WB (Western Blot)

(DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in NIH/3T3.)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – WB (Western Blot) WB (Western Blot) (DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in NIH/3T3.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.77kD).)

Mouse Anti-DNAJC10 Monoclonal Antibody – Cat# AAA25375 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (37.77kD).)
Product Categories/Family for anti-DNAJC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 10 isoform 2
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C10
NCBI Official Symbol
DNAJC10
NCBI Official Synonym Symbols
JPDI; MTHr; ERdj5; PDIA19
NCBI Protein Information
dnaJ homolog subfamily C member 10
UniProt Protein Name
DnaJ homolog subfamily C member 10
UniProt Gene Name
DNAJC10
UniProt Synonym Gene Names
ERDJ5; ER-resident protein ERdj5; ERdj5; MTHr
UniProt Entry Name
DJC10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DNAJC10 dnajc10 (Catalog #AAA25375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC10 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJC10 dnajc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJC10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.