Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25372_WB6.jpg WB (Western Blot) (Western Blot analysis of DHFR expression in HeLa.)

Mouse anti-Human, Rat DHFR Monoclonal Antibody | anti-DHFR antibody

DHFR (Dihydrofolate reductase) (HRP)

Gene Names
DHFR; DYR; DHFRP1
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHFR, Antibody; DHFR (Dihydrofolate reductase) (HRP); anti-DHFR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human DHFR. Species Crossreactivity: rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1133
Applicable Applications for anti-DHFR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa88-187 of human DHFR (BC003584; AAH03584) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of DHFR expression in HeLa.)

product-image-AAA25372_WB6.jpg WB (Western Blot) (Western Blot analysis of DHFR expression in HeLa.)

IF (Immunofluorescence)

(Immunofluorescence on HeLa cells using 125814 (10ug/ml).)

product-image-AAA25372_IF5.jpg IF (Immunofluorescence) (Immunofluorescence on HeLa cells using 125814 (10ug/ml).)

Application Data

(Detection limit for 125814 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25372_APP4.jpg Application Data (Detection limit for 125814 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of DHFR expression in transfected 293T cell line using 125814. Lane 1: DHFR transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA25372_WB3.jpg WB (Western Blot) (Western Blot analysis of DHFR expression in transfected 293T cell line using 125814. Lane 1: DHFR transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot analysis of DHFR expression in PC-12 using 125814.)

product-image-AAA25372_WB2.jpg WB (Western Blot) (Western Blot analysis of DHFR expression in PC-12 using 125814.)

WB (Western Blot)

(Western Blot detection against immunogen (36.74kD).)

product-image-AAA25372_WB.jpg WB (Western Blot) (Western Blot detection against immunogen (36.74kD).)
Related Product Information for anti-DHFR antibody
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia.
Product Categories/Family for anti-DHFR antibody
References
1. Influence of Reduced Folate Carrier and Dihydrofolate Reductase Genes on Methotrexate-Induced Cytotoxicity. Yoon SA, Choi JR, Kim JO, Shin JY, Zhang X, Kang JH.Cancer Res Treat. 2010 Sep;42(3):163-71. Epub 2010 Sep 30. 2. Telomere capping in non-dividing yeast cells requires Yku and Rap1. Vodenicharov MD, Laterreur N, Wellinger RJ.EMBO J. 2010 Jul 13. 3. Anticancer drug encapsulated in inorganic lattice can overcome drug resistance. Choi SJ, Choi GE, Oh JM, Oh YJ, Park MC, Choy JH.J. Mater. Chem., 2010, 20, 9463-9469. 4. Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes. Ionova IA, Vasquez-Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley BC, Pieper GM.Am J Physiol Heart Circ Physiol. 2008 Nov;295(5):H2178-87. Epub 2008 Oct 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens dihydrofolate reductase, mRNA
NCBI Official Synonym Full Names
dihydrofolate reductase
NCBI Official Symbol
DHFR
NCBI Official Synonym Symbols
DYR; DHFRP1
NCBI Protein Information
dihydrofolate reductase

Similar Products

Product Notes

The DHFR (Catalog #AAA25372) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHFR (Dihydrofolate reductase) (HRP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHFR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHFR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHFR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.